SecReT6
Protein ID: 384173009
SecReT6 ID586
T6SS typei1
Gene symbol-
Locus tagABLL_2194
StrainArcobacter sp. L
Repliconchromosome [GenBank: NC_017192] [Browse all T6SS(s) in this replicon]
Location [Strand]2248556..2249080 [+]
Producthypothetical protein
NoteTssD
UniProt IDG2HY66
KEGG IDarc:ABLL_2194
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.90E-38, Aligned region: 6..155
Protein Sequence: 174 a.a.     [Download]
>gi|384173009|ref|YP_005554386.1| hypothetical protein [Arcobacter sp. L]
MNNPVFISIKGSTQGLITEGAFTAESVGNSFQKGHENEALVKAFNHNIKIPRDPQSGQPSGQRVHEPLVI
TKLVDKSTPLLYNALTKGETLTNVELKWYRTSYTGKPEHYFSLVLEDAVIVNIDSFMDMQVGETKVQVAP
LEKISFAYRKITWRHEVASTSGEDDWRIGVGLNA
 
Nucleotide Sequence: 525 bp     [Download]
>gi|384170815|ref|NC_017192.1|:2248556-2249080 Arcobacter sp. L, complete genome
ATGAATAATCCAGTATTTATTTCAATTAAAGGAAGTACTCAAGGTTTGATTACTGAAGGAGCATTTACTG
CTGAATCTGTTGGAAACTCGTTTCAAAAAGGACATGAAAATGAAGCTTTAGTAAAAGCTTTTAATCACAA
TATTAAAATTCCAAGAGATCCTCAATCTGGACAACCTTCAGGTCAAAGAGTTCATGAACCTTTAGTTATT
ACAAAACTTGTAGATAAATCTACACCACTTTTATATAATGCATTAACAAAAGGTGAAACATTAACTAATG
TAGAATTAAAATGGTATAGAACAAGTTATACAGGAAAACCAGAACATTATTTTAGTTTAGTATTAGAAGA
TGCTGTAATTGTAAATATTGATTCATTTATGGATATGCAAGTAGGAGAAACTAAAGTTCAAGTTGCTCCT
TTAGAAAAAATTTCTTTTGCTTATAGAAAAATCACTTGGAGACATGAAGTAGCAAGCACTTCAGGAGAAG
ATGATTGGAGAATAGGCGTAGGATTAAATGCTTAA