SecReT6
Protein ID: 384173010
SecReT6 ID586
T6SS typei1
Gene symbol-
Locus tagABLL_2195
StrainArcobacter sp. L
Repliconchromosome [GenBank: NC_017192] [Browse all T6SS(s) in this replicon]
Location [Strand]2249134..2251980 [+]
Producthypothetical protein
NoteTssI
UniProt IDG2HY67
KEGG IDarc:ABLL_2195
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 9.00E-18, Aligned region: 393..484
Phage_GPD [PF05954], Evalue: 1.90E-15, Aligned region: 50..274
Protein Sequence: 948 a.a.     [Download]
>gi|384173010|ref|YP_005554387.1| hypothetical protein [Arcobacter sp. L]
MKEILDLLSTKATLQKVKGRIKLLNYKQEEIKGLIEEDYSIYSLTGNSNIDEIYSFNVSFISNEFLNIDL
LLDTDVEIIIEDLINLRIKKNIFGKICKIEEDSIVAKKYMYKIEVVHPLYYLNFTNKYEIFQNKKFEDII
YEIIQRYSALLNTSLEIRIDKDKTPIREYTTQYNQSDLDFIMMLAQTEGYNLIFDYSNNQPYKVILCQLN
DYALVNPVIKSISNFNIIKKFNATSHIEDYYDYNRPSKEYKINSNVYKENEEENPNSKQLQQELKVEKLK
DKLNLLNESYYEDLTRYSNIDSLRETSKIKTIKAYSKEIQLKDSLLVELYDDKVNKSKEVIILGVKYKAY
FPNALDEYTTLNQTLQYEVEVTCIPKEIIYKPNKTIKQSKIYGIQTAIVSNNENNLKEEENNIDVDEQGR
VRVVFHFERNKTTSCYLRVSNISSGNNYGSMFIPRVNSEVIVSFINGDPDKPIIIGSLYNGENKIAHSLP
NNKTKSYIRTYTTPQYEDEIGFNEILFEDKQGEEELNIKAQRDMNSLIQNDETRIVKHNQKIIIENDKIE
DIKRDSKIIINNEQIVEVKSNSKEKIEKDKELTVEEDYDINVNKNLNLLVNDNLKQIIEKDFTLRVKGNQ
TEYVEKDVKKKYLQNLFLQISNNFRLDIKNNYHINANSIKQEANKIEIIANEAITLRSNSNCLTINKSGI
FLKTNNLDTTSSYSGVFANDVEKVNIQKPLYEKLKIVSIEANILKQNSINDSLIFNANTLLYKNDSWIQS
NTLSSSQLSLLQWHFIKNNDSFDNDLHSDFISKDNITIDGLNLIVNLERNNLYKYAHIFCFTNNHKEEGY
ILIELKRNIKVIDIKIKYLSNEEIEATAILNIVEPTQEELNQIRWNIEGNLISKYNGLQTIKHNIKKENI
YEINFYSFIINNQNIQDYANAFAVFDEDEKKLNDLGIN
 
Nucleotide Sequence: 2847 bp     [Download]
>gi|384170815|ref|NC_017192.1|:2249134-2251980 Arcobacter sp. L, complete genome
ATGAAAGAAATTTTAGATTTATTATCAACAAAAGCGACATTGCAAAAAGTAAAAGGTAGAATAAAATTAT
TAAACTATAAGCAAGAAGAGATAAAAGGATTAATAGAAGAGGATTATTCAATTTATTCTTTAACAGGGAA
TAGTAATATAGATGAAATATATAGTTTTAATGTATCTTTTATAAGTAATGAATTTTTAAATATTGATTTA
TTATTAGATACTGATGTAGAAATTATAATTGAAGATTTAATAAATTTAAGAATAAAAAAAAATATATTTG
GAAAAATTTGTAAAATAGAAGAAGATTCGATTGTTGCAAAAAAATATATGTATAAAATTGAAGTAGTACA
TCCTTTATATTATTTAAACTTTACAAATAAATATGAAATATTTCAGAATAAAAAATTTGAAGATATTATT
TATGAAATAATACAAAGATATTCAGCATTATTAAATACATCTTTAGAGATAAGAATAGATAAAGATAAAA
CACCAATAAGAGAATATACAACTCAATATAATCAAAGTGATTTAGATTTTATAATGATGTTAGCTCAAAC
AGAAGGATATAATTTAATATTTGATTATAGTAATAATCAACCATATAAAGTAATACTATGCCAATTAAAT
GATTATGCTTTAGTAAATCCAGTAATAAAATCAATTTCTAATTTTAATATAATCAAAAAATTTAATGCAA
CTTCTCATATAGAGGATTATTATGATTATAATAGACCAAGTAAAGAATATAAAATAAATAGTAATGTATA
TAAAGAAAATGAAGAAGAAAATCCAAATAGTAAACAATTACAACAAGAATTAAAAGTAGAAAAATTAAAA
GATAAATTGAATCTATTAAATGAGAGTTATTATGAAGATTTAACTAGATATAGTAATATAGATTCATTAA
GAGAAACTTCAAAAATAAAAACAATAAAAGCTTATTCAAAAGAGATACAACTAAAAGATAGTTTATTAGT
AGAACTATATGATGATAAAGTAAATAAATCAAAAGAAGTAATAATATTAGGAGTGAAATATAAAGCATAC
TTTCCAAATGCTTTAGATGAATATACAACTTTAAATCAAACCTTACAATATGAAGTAGAAGTAACTTGTA
TTCCAAAAGAAATAATATATAAACCAAATAAAACAATAAAACAATCAAAAATATATGGAATACAAACAGC
AATAGTTTCAAATAATGAGAATAATTTAAAAGAAGAAGAGAATAATATAGATGTAGATGAACAAGGAAGA
GTAAGAGTGGTGTTTCATTTTGAAAGAAATAAAACAACATCTTGTTACTTAAGAGTGTCAAATATTTCAA
GTGGAAATAACTATGGTTCAATGTTTATACCAAGAGTAAATAGTGAAGTAATAGTAAGCTTTATAAATGG
AGACCCCGATAAACCAATAATAATAGGGAGCTTATATAATGGTGAGAATAAAATAGCACATTCTTTGCCA
AATAATAAAACAAAAAGTTATATAAGAACATATACGACACCACAATATGAAGATGAAATAGGATTTAATG
AGATATTGTTTGAAGATAAACAAGGAGAAGAAGAATTAAATATAAAAGCACAAAGAGATATGAACTCTTT
AATACAAAATGATGAGACAAGAATAGTAAAACATAATCAAAAGATAATAATAGAGAATGATAAGATAGAA
GATATAAAAAGAGATTCAAAAATAATAATAAATAATGAACAAATAGTAGAAGTAAAATCAAATAGTAAAG
AGAAGATAGAGAAAGATAAAGAATTAACAGTTGAAGAGGATTATGATATTAATGTTAACAAAAATCTTAA
TCTTTTGGTTAATGATAATTTAAAACAAATAATAGAAAAAGATTTTACATTAAGAGTAAAAGGAAATCAA
ACGGAATATGTAGAAAAAGATGTGAAAAAAAAGTATTTACAAAATCTTTTTTTACAAATTTCTAATAATT
TTAGACTTGACATAAAAAACAATTATCATATCAATGCAAACTCAATAAAACAAGAAGCAAATAAAATTGA
GATTATTGCTAATGAAGCTATTACTTTAAGAAGTAATTCTAATTGTTTAACTATCAATAAAAGTGGCATT
TTTTTAAAAACTAATAATTTAGACACTACTTCTTCTTATTCTGGGGTATTTGCAAATGATGTAGAAAAAG
TTAATATTCAAAAACCTCTTTATGAAAAGCTCAAAATAGTTTCTATTGAAGCCAATATTCTCAAACAAAA
TTCTATAAATGATTCTTTAATTTTTAATGCTAATACTTTACTTTATAAAAATGATTCATGGATTCAATCT
AATACTTTATCCTCTTCTCAACTCTCTTTATTACAGTGGCATTTTATAAAAAACAATGACTCTTTTGACA
ATGATCTTCATTCTGATTTTATCTCTAAAGATAATATTACTATTGATGGTTTAAATCTAATCGTTAATCT
TGAAAGAAACAATTTATATAAATATGCTCATATTTTCTGTTTTACTAATAATCACAAAGAAGAAGGTTAT
ATTTTAATAGAATTAAAAAGAAATATTAAAGTAATTGATATAAAAATAAAATATCTTTCTAATGAAGAGA
TTGAAGCTACTGCTATTCTAAATATTGTAGAACCAACTCAAGAGGAGTTAAATCAAATCAGATGGAATAT
AGAAGGTAATCTTATCTCTAAATATAATGGTTTACAAACTATAAAACACAATATAAAAAAAGAGAATATT
TATGAAATAAACTTTTATTCATTTATAATCAATAATCAAAATATTCAAGATTATGCTAATGCTTTTGCTG
TGTTTGATGAGGATGAAAAAAAATTAAATGATTTAGGGATAAATTAA