SecReT6
Protein ID: 384412743
SecReT6 ID588
T6SS typei1
Gene symbol-
Locus tagYPC_0045
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]51213..51710 [+]
Producthypothetical protein
NoteTssB
UniProt IDE8P2U6
KEGG IDyph:YPC_0045
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.60E-57, Aligned region: 7..160
Protein Sequence: 165 a.a.     [Download]
>gi|384412743|ref|YP_005622105.1| hypothetical protein YPC_0045 [Yersinia pestis biovar Medievalis str. Harbin 35] [TssB]
MSKNKQSSVAPKERINIKYVPNTGDQVAEIELPLNLLVVGDLKGVREETSIEERQVVSVNKNNFNSVMNE
ANISLSFNVPNRLEGDGEEDMPVALSIKGLDDFSPDNVAKKVPELKKILELREALVALKGPLGNIPAFRS
RLQDLLGNEDMREQLLKELDILNQK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|384412706|ref|NC_017265.1|:51213-51710 Yersinia pestis biovar Medievalis str. Harbin 35, complete sequence [TssB]
ATGAGTAAAAATAAGCAAAGCAGTGTTGCCCCAAAAGAAAGGATTAACATCAAGTATGTGCCGAATACTG
GCGACCAGGTTGCAGAAATTGAATTACCGCTGAATCTGCTGGTTGTGGGTGATCTTAAAGGCGTGCGTGA
AGAGACTTCAATTGAAGAGCGTCAGGTTGTTTCGGTCAATAAGAATAACTTCAACTCAGTCATGAACGAA
GCAAATATCAGTCTGAGTTTCAATGTGCCTAATCGCCTTGAAGGTGATGGGGAAGAAGACATGCCGGTCG
CCTTGTCGATCAAGGGTCTTGATGATTTCTCGCCTGACAATGTGGCGAAAAAAGTTCCAGAGCTCAAAAA
AATTCTGGAACTACGGGAAGCGTTAGTGGCATTGAAAGGGCCATTGGGGAATATCCCAGCTTTCCGCTCT
CGTCTACAGGATTTGCTTGGCAATGAAGATATGCGCGAGCAGTTGCTGAAAGAATTGGACATTCTTAATC
AAAAATAA