SecReT6
Protein ID: 384412745
SecReT6 ID588
T6SS typei1
Gene symbol-
Locus tagYPC_0047
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]53266..53706 [+]
Producthypothetical protein
NoteTssE
UniProt IDE8P2U8
KEGG IDyph:YPC_0047
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-19, Aligned region: 32..122
Protein Sequence: 146 a.a.     [Download]
>gi|384412745|ref|YP_005622107.1| hypothetical protein YPC_0047 [Yersinia pestis biovar Medievalis str. Harbin 35]
MAALLNWDRGSSASLFDRIQGKGASSSSDGRLRELLNSIQKHLNEVLNSRPGACQSAVDLGVIDLNDATA
TSSDFRKSIEKAIKDCIENYEPRISAVTVQSLLNHGDPLQLSFHISARVNFDDMGDVVEFNIQLDNNRRY
CFNQET
 
Nucleotide Sequence: 441 bp     [Download]
>gi|384412706|ref|NC_017265.1|:53266-53706 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGGCCGCGCTTCTTAATTGGGATCGAGGGAGTTCTGCCAGTTTGTTTGACCGCATACAGGGGAAGGGCG
CTAGCTCTTCCTCCGATGGCCGTCTGCGTGAGCTATTGAATTCAATCCAAAAGCATTTGAACGAGGTCCT
TAACTCTCGTCCAGGTGCTTGCCAAAGTGCGGTCGATCTCGGGGTTATCGACCTCAATGATGCGACCGCC
ACCTCATCTGATTTTCGAAAAAGTATTGAGAAAGCCATTAAGGATTGTATCGAGAACTACGAACCCCGAA
TTTCTGCCGTTACAGTTCAATCCTTGCTGAACCATGGCGACCCACTGCAACTGAGTTTCCATATTAGCGC
TCGTGTTAATTTCGACGATATGGGTGATGTCGTTGAGTTCAACATTCAGTTAGACAATAACCGCCGTTAC
TGCTTTAACCAGGAAACATAA