SecReT6
Protein ID: 384412746
SecReT6 ID588
T6SS typei1
Gene symbol-
Locus tagYPC_0048
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]53706..54224 [+]
ProductProtein ImpG/VasA
NoteTssF
UniProt IDE8P2U9
KEGG IDyph:YPC_0048
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.50E-54, Aligned region: 3..150
Protein Sequence: 172 a.a.     [Download]
>gi|384412746|ref|YP_005622108.1| Protein ImpG/VasA [Yersinia pestis biovar Medievalis str. Harbin 35]
MSFEKYFRDELDYLRQLGRDAAIERPHLAAFLSEQGSDPDVERLLEGFAFLTGNLREKIDDQFPELTHGL
LNMLWPNYLRPIPSMTIIEYTPDESVVTEATLVKRGSQVMSIPIAQNGQRSAFINSNAHAGPQCTFTLCR
DVWLFPMSIVTNGAIVIHTQRLKSDPGGNLLS
 
Nucleotide Sequence: 519 bp     [Download]
>gi|384412706|ref|NC_017265.1|:53706-54224 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGTCGTTCGAAAAGTATTTCAGGGACGAGCTGGACTACCTCCGGCAATTAGGACGCGATGCCGCAATAG
AACGGCCTCATCTCGCTGCATTTTTATCTGAGCAAGGTTCTGATCCGGATGTTGAACGTTTGCTGGAAGG
CTTTGCTTTTCTAACGGGCAACCTGCGTGAAAAAATCGATGATCAATTCCCTGAATTGACTCATGGTTTA
CTGAATATGTTGTGGCCGAACTACTTACGGCCAATACCGAGCATGACCATCATCGAGTACACACCGGATG
AAAGTGTGGTCACCGAGGCGACGCTGGTGAAACGGGGTAGCCAAGTGATGAGTATCCCCATCGCACAAAA
TGGTCAGCGCAGCGCGTTTATCAACAGTAATGCTCATGCCGGGCCACAATGTACTTTTACGTTGTGCCGT
GATGTGTGGTTGTTCCCCATGTCCATTGTAACGAACGGTGCAATAGTGATCCACACCCAACGCCTGAAAT
CAGATCCAGGGGGTAATCTGCTCTCCTGA