SecReT6
Protein ID: 384412749
SecReT6 ID588
T6SS typei1
Gene symbol-
Locus tagYPC_0051
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]56055..56891 [+]
ProductProtein ImpG/VasA
NoteTssF
UniProt IDE8P2V2
KEGG IDyph:YPC_0051
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.80E-63, Aligned region: 26..224
Protein Sequence: 278 a.a.     [Download]
>gi|384412749|ref|YP_005622111.1| Protein ImpG/VasA [Yersinia pestis biovar Medievalis str. Harbin 35]
MGRWWRYKWITFHPSLTSIREISANSSNEQGILSIHFAAKAELNLQDLQLDKLRFYLGEDNYTSTQLYFW
INHYFERAELVVNGITIPMPDFDFNPVGFERDDALLPYPKNAYMGYRILQEYFCFPEGFLFFDVNGVVDF
PPHLNASEFSLNLYFSQALPPEVKVRSTTLRMNCTPAVNLFQHDSEAIDLDGTQTEYPLCVSYHNPDHYD
IFSVDRVDSWLSEKGVPKGRGRALNPKTWTSALLLFYLSPVFCRTHSACFQANALCIVIMDIFYNVTL
 
Nucleotide Sequence: 837 bp     [Download]
>gi|384412706|ref|NC_017265.1|:56055-56891 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
TTGGGCCGTTGGTGGAGATATAAGTGGATCACTTTTCATCCGTCGTTGACATCCATCCGGGAGATCTCGG
CGAACAGCAGTAACGAACAAGGCATTTTGAGTATTCACTTTGCCGCCAAAGCGGAATTGAACTTACAAGA
CCTGCAATTGGATAAATTGCGCTTTTATCTGGGCGAAGACAACTACACCAGCACACAACTCTATTTCTGG
ATTAACCACTATTTCGAACGCGCTGAACTGGTTGTCAACGGGATAACCATCCCGATGCCTGATTTTGACT
TTAACCCAGTGGGCTTTGAACGCGATGATGCCCTCTTGCCGTACCCGAAAAACGCCTATATGGGTTACCG
GATCCTGCAAGAATATTTTTGCTTCCCCGAAGGCTTTTTGTTCTTTGATGTCAATGGTGTGGTCGATTTT
CCGCCGCACTTGAATGCCAGTGAATTCTCTCTGAATTTGTATTTCTCTCAGGCATTGCCGCCTGAAGTGA
AAGTCCGCTCCACCACACTGCGGATGAATTGCACACCTGCGGTGAACCTGTTCCAACATGACAGTGAAGC
GATTGATCTTGATGGAACCCAGACGGAATATCCGCTCTGTGTCAGCTACCATAATCCGGATCACTACGAC
ATCTTTTCAGTTGATCGGGTTGACAGTTGGCTCAGTGAAAAAGGTGTTCCTAAGGGGCGCGGCCGTGCAC
TGAACCCCAAAACTTGGACATCTGCTTTACTGCTTTTCTACCTGAGTCCGGTATTCTGCCGGACTCATTC
CGCCTGTTTTCAGGCTAATGCGCTCTGTATTGTAATAATGGATATATTCTACAATGTCACGCTTTAA