SecReT6
Protein ID: 384413435
SecReT6 ID589
T6SS typei2
Gene symbol-
Locus tagYPC_0818
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]822831..823331 [+]
Producthypothetical protein
NoteTssB
UniProt IDE8NYT0
KEGG IDyph:YPC_0818, yph:YPC_2692
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.40E-56, Aligned region: 7..159
Protein Sequence: 166 a.a.     [Download]
>gi|384413435|ref|YP_005622797.1| hypothetical protein YPC_0818 [Yersinia pestis biovar Medievalis str. Harbin 35]
MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNINKNNFNSVLAE
FQPSLKLAVPDTLAGDNTDTAVSLTFNDMKDFEPENVARQIPQLRALLAMRNLLRDLKSNLLDNATFRRE
LENILKDDALSDELRAELAALAPKEG
 
Nucleotide Sequence: 501 bp     [Download]
>gi|384412706|ref|NC_017265.1|:822831-823331 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGTCCTCTTCAAGCTTCCAAAATGAGATACCTAAAGCACGCATTAACATCAAATTAGACCTGCATACTG
GCGGGGCGCAAAAGAAAGTCGAACTGCCTTTGAAGTTGTTGGTGATGGGCGATTACAGCAACGGTCAGGA
GCAGCGCCCGCTGTCTGAACGTGAAAAACTCAATATCAATAAAAATAATTTTAACAGTGTGCTGGCTGAA
TTCCAACCGAGCCTGAAACTCGCTGTACCGGACACGCTGGCCGGGGATAACACCGATACAGCCGTCTCCC
TGACCTTCAACGACATGAAAGATTTCGAGCCAGAAAACGTGGCCCGTCAAATTCCGCAACTGCGTGCCTT
GCTGGCCATGCGCAACCTGCTGCGAGACCTTAAATCCAATCTGCTGGACAACGCCACCTTCCGCCGTGAG
CTGGAAAATATCCTCAAAGACGATGCCTTGAGCGATGAACTGCGCGCTGAACTGGCGGCCCTGGCGCCAA
AAGAGGGTTAA