SecReT6
Protein ID: 384413436
SecReT6 ID589
T6SS typei2
Gene symbol-
Locus tagYPC_0819
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]823374..824918 [+]
Producthypothetical protein
NoteTssC
UniProt IDE8NYT1
KEGG IDyph:YPC_0819
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.50E-175, Aligned region: 15..53
DUF877 [PF05943], Evalue: 8.50E-175, Aligned region: 92..510
Protein Sequence: 514 a.a.     [Download]
>gi|384413436|ref|YP_005622798.1| hypothetical protein YPC_0819 [Yersinia pestis biovar Medievalis str. Harbin 35]
MLMSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIEAFQNNDALAEATTDERVTAAVSV
FLDLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLDAVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIE
LLDISKDHLVQDFEDAPEISQSGLYAQTYIQEYDTPGGEPIAAAISNYEFDRSPQDIALLRNISKVAAAA
HMPFIGSVGPEFFGKENMEDVAAIKDIANYFDRAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVP
VRSFNYVEQVKGPDHDRYLWTNASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYDLGTGNQVK
IPSEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADATANSRINARLPYIFLLSRI
AHYLKLIQRENIGTTKDRRLLELNNWVRGLVTEMTDPGDDLQASHPLRDAKVTVEDIEDNPGFFRVKLYA
VPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|384412706|ref|NC_017265.1|:823374-824918 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGCTGATGTCTGTACAGGAAAACCGTGCGCAGGGTACTGCGACGACCGTATTAAAGAATAGCCCTGCGG
CACAAGGGGTTTACGCCGCCTTGTTTGAAAAAATCAACCTGAGCCCGGTCTCCTCACTGGCCGGTATCGA
GGCGTTCCAGAACAACGATGCGCTGGCGGAAGCCACCACCGATGAGCGCGTTACCGCCGCCGTCAGTGTC
TTTTTAGACCTGCTGAAGCAGTCGGCGAAGAAAGTAGAAAAACTGGATAAAACCCTGCTGGACGGCCATA
TTGCCGCACTGGATGACCAAATCAGCCGCCAGTTGGACGCGGTAATGCACCACCCCGATTTCCAGCGGGT
GGAATCGACCTGGCGTGGTGTGAAGTCGCTGATCGATCAGACCGATTTCCGCCAGAACGTGCGCATCGAG
CTGCTGGATATCAGTAAAGATCATCTGGTGCAGGATTTTGAAGATGCCCCGGAAATCTCACAAAGCGGTT
TATACGCCCAGACCTATATTCAGGAATACGACACCCCCGGCGGCGAGCCGATTGCCGCGGCTATCTCCAA
CTACGAGTTCGACCGTAGCCCGCAAGATATCGCGTTATTGCGCAATATCTCCAAGGTCGCGGCGGCAGCC
CATATGCCGTTTATCGGTTCCGTTGGCCCCGAGTTCTTTGGTAAAGAGAACATGGAAGACGTGGCAGCCA
TCAAAGATATCGCCAACTACTTTGACCGTGCTGAATACATCAAGTGGAAAGCCTTCCGCGACTCGGATGA
TTCCCGCTATATCGGCCTGACCATGCCGCGCGTGCTGGGGCGTTTGCCTTACGGCCCGGACACGGTGCCG
GTACGCAGCTTCAACTACGTTGAGCAGGTGAAAGGGCCGGATCATGATCGCTACTTGTGGACCAATGCCT
CATTTGCCTTTGCTGCTAACATGGTGAAAAGCTTCATTAAAAATGGCTGGTGTGTGCAGATCCGGGGCCC
GCAGGCCGGTGGTGCGGTCACCAACTTACCGATCCACCTGTACGATCTGGGTACCGGTAATCAGGTCAAA
ATTCCGTCAGAGGTGATGATCCCGGAAACCCGCGAGTTCGAGTTTGCCAATCTGGGCTTTATCCCGCTGT
CGTACTACAAAAACCGCGATTACTCGTGCTTCTTCTCGGCCAACTCGGCGCAGAAACCGGCGCTGTATGA
CACCGCGGATGCCACGGCCAACAGCCGCATCAACGCCCGTTTGCCGTATATCTTCCTGCTGTCGCGCATT
GCCCATTATCTGAAACTGATCCAGCGCGAGAACATCGGCACCACCAAAGATCGCCGTCTGCTGGAGCTGA
ACAACTGGGTGCGCGGGCTGGTGACGGAAATGACTGATCCGGGTGATGATTTGCAGGCGTCCCATCCCCT
GCGTGATGCCAAAGTGACGGTCGAAGATATCGAAGACAACCCCGGCTTCTTCCGCGTCAAGCTGTATGCG
GTGCCGCATTTCCAGGTGGAAGGGATGGACGTCAATCTGTCATTGGTTTCCCAAATGCCAAAGGCTAAGG
CATAA