SecReT6
Protein ID: 384413438
SecReT6 ID589
T6SS typei2
Gene symbol-
Locus tagYPC_0821
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]826279..826965 [+]
Producthypothetical protein
NoteTssL
UniProt IDE8NYT3
KEGG IDyph:YPC_0821, yph:YPC_2689
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-47, Aligned region: 14..216
Protein Sequence: 228 a.a.     [Download]
>gi|384413438|ref|YP_005622800.1| hypothetical protein YPC_0821 [Yersinia pestis biovar Medievalis str. Harbin 35]
MNPHLTEHPPVGDIDALLQDTWLQVISLRQGVTCAEGEGQAFWQRCVADIERVHQALKDAGHSEQSCQHI
RYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHFFNTLDAGSQLYERMRAVLREPAPDRAVLTCFHRVLM
LGFLGGYASPAASEREQLIDQLSVQVPAFSVAPSRGILASAASRNRLGIWLRYWPVRLGLAALMVALLWW
GLDHWLSGLLATLLPEPV
 
Nucleotide Sequence: 687 bp     [Download]
>gi|384412706|ref|NC_017265.1|:826279-826965 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGAATCCTCACCTAACCGAACACCCCCCAGTCGGGGATATTGACGCCCTGTTGCAGGACACCTGGCTAC
AGGTGATCAGCCTGCGTCAAGGGGTAACCTGTGCCGAGGGCGAAGGGCAGGCATTCTGGCAGCGCTGTGT
GGCGGACATTGAACGTGTCCATCAGGCGCTGAAAGACGCCGGTCACAGCGAGCAGAGTTGCCAGCACATC
CGATACGCCCAATGTGCACTGCTGGATGAGACCGTGAAAGGGCGCGGTGTACAGGATGATGCCTACTTCG
TGTGGTGCCATTCGCCCTTACAGGCGCATTTTTTCAATACCCTGGATGCCGGTAGCCAGCTTTACGAGCG
GATGCGCGCCGTGTTGCGTGAGCCTGCGCCGGATCGCGCGGTACTGACCTGTTTTCACCGGGTATTGATG
TTGGGCTTCCTCGGCGGGTACGCCTCCCCGGCGGCTTCTGAACGGGAGCAACTGATCGATCAACTGAGCG
TGCAGGTACCGGCGTTCAGTGTCGCGCCATCACGTGGGATCCTGGCAAGCGCCGCCTCCCGCAACCGGTT
GGGGATCTGGTTGCGTTACTGGCCGGTACGGCTCGGGCTGGCTGCGCTGATGGTCGCGCTGTTGTGGTGG
GGCCTTGATCACTGGCTGTCCGGTCTGTTAGCCACCTTACTGCCGGAGCCGGTGTAA