SecReT6
Protein ID: 384415139
SecReT6 ID591
T6SS typei2
Gene symbol-
Locus tagYPC_2667
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]2579949..2580530 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDE8P336
KEGG IDyph:YPC_2667
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.70E-39, Aligned region: 31..186
Protein Sequence: 193 a.a.     [Download]
>gi|384415139|ref|YP_005624501.1| putative lipoprotein [Yersinia pestis biovar Medievalis str. Harbin 35]
MLTTVWKNKTCTSKHKSWAAWKNKICIPALVLLLSGCGLTQAVTDSTVSATKSLFYKQIKVLHLDFTARE
ALNTDAHEANSSSEPVMVRVYQLRDDKTFLKTVYQQLASDGEAALKDDLLASRSVVVKPGGAVTLDMPME
KETQFVAVVALFRHPDMAKDHWRLILTLDDLHPDKPRTLELGNNSLTLRTEKK
 
Nucleotide Sequence: 582 bp     [Download]
>gi|384412706|ref|NC_017265.1|:c2580530-2579949 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
GTGTTAACTACCGTTTGGAAAAATAAAACCTGTACTTCGAAACATAAAAGCTGGGCCGCCTGGAAAAATA
AAATCTGCATCCCCGCACTGGTCTTGTTGCTCAGTGGCTGCGGGCTGACGCAAGCCGTGACCGATAGCAC
CGTGTCGGCCACAAAATCACTGTTTTATAAGCAGATAAAGGTGCTGCATCTGGACTTTACCGCCCGTGAA
GCCCTGAATACCGATGCGCACGAGGCGAACTCGTCATCGGAGCCGGTAATGGTGCGGGTTTATCAGTTAC
GTGATGATAAAACCTTCCTCAAAACGGTGTATCAACAACTGGCAAGCGACGGGGAGGCGGCGCTTAAAGA
TGACCTGCTGGCCAGCCGCAGTGTGGTGGTGAAACCGGGCGGGGCGGTAACACTGGATATGCCGATGGAA
AAAGAGACCCAGTTTGTGGCAGTGGTGGCGCTGTTCCGTCATCCGGATATGGCCAAAGACCACTGGCGTC
TGATACTCACGCTGGACGACCTGCATCCCGATAAGCCCCGTACCCTTGAGTTGGGTAATAACAGCCTGAC
CCTGCGGACGGAGAAAAAATAA