SecReT6
Protein ID: 384415141
SecReT6 ID591
T6SS typei2
Gene symbol-
Locus tagYPC_2669
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]2581554..2583317 [-]
Producthypothetical protein
NoteTssF
UniProt IDE8P338
KEGG IDyph:YPC_2669
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.00E-183, Aligned region: 6..583
Protein Sequence: 587 a.a.     [Download]
>gi|384415141|ref|YP_005624503.1| hypothetical protein YPC_2669 [Yersinia pestis biovar Medievalis str. Harbin 35]
MDDLTLRYFDAEMRYLREAGEEFARAHPDRAAGLNLDKAGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSIVEFTPQWQGMKERMGVSKGFEVLSRPIGERETRCRYTTTQEMDLLPLT
LRRAGLDSEPDGRSVIRLRFDCSALADWSRINLSRLPLYFDADAPLACALHEALTLNTAKLWIRLPGQAD
RQPLDGHFAPLGFGEQDTLWPKADSAFSGYQLLLEYFTFREKFMFVALQGLDGIELPAELPWFEIDVVLE
KRWQHDFSFSEKNLRLHCVPVINLFPLESDPLSLSSLQTEYLLRPMRIQDGYTEVYSVDSVISSRHTGHQ
VYVPFTSFRHKGGMLRHDAPEYYYHTRVKRGPSGLHDTWLVLGGEAFDNHSVPDNENLSLSLTGTNGQLP
RKALQSTVLDTAVKSTGAQVRVRNLSAPSLPCYPPNRDRFHWRVLSHLGSSFLWMMDNAEVLRGTLALYD
WTDNEMNRRRLEAIAEVKHSEIERFERGYLLRGVHIEITLDSNGFTGTGDICLFGEMLSRFFALYTDIHL
FNRLTLILQPTGERLEWEENHQSRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|384412706|ref|NC_017265.1|:c2583317-2581554 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGGACGACTTAACCCTGCGTTATTTTGACGCTGAAATGCGCTACCTGCGCGAAGCGGGCGAAGAGTTTG
CTCGTGCGCACCCTGATCGGGCTGCCGGATTAAATCTGGATAAAGCCGGGGCGCGTGACCCCTATGTCGA
ACGCCTATTTGAAGGCTTTGCCTTTCTGATGGGCCGACTGCGGGAAAAACTGGATGACGACCTGCCGGAA
CTGACCGAAGGGTTGGTCAGCCTGCTGTGGCCGCACTACCTGCGTACCATTCCGTCGCTTTCTATTGTGG
AGTTCACCCCACAATGGCAGGGGATGAAAGAGCGCATGGGGGTGAGTAAAGGTTTTGAAGTGCTGTCCCG
CCCCATTGGTGAACGTGAAACCCGTTGCCGCTATACCACCACGCAAGAGATGGACCTGCTCCCGCTGACC
CTGCGCCGTGCCGGGCTGGACAGTGAACCCGATGGCCGGTCGGTTATCCGGCTGCGCTTTGATTGCAGCG
CGCTGGCCGACTGGAGCCGTATCAACCTGAGCCGCCTGCCGCTCTATTTTGATGCCGATGCGCCGCTGGC
CTGCGCCCTGCATGAGGCGCTGACCCTGAATACCGCCAAACTCTGGATCCGTTTGCCGGGGCAGGCTGAT
CGCCAGCCGCTGGACGGCCATTTCGCGCCGCTGGGGTTCGGGGAGCAGGATACACTGTGGCCGAAGGCCG
ACAGTGCGTTCAGTGGTTATCAGCTCTTGCTGGAGTACTTTACCTTCCGCGAAAAGTTTATGTTTGTCGC
GTTGCAGGGGCTGGATGGGATCGAGCTGCCGGCGGAACTGCCGTGGTTTGAGATTGATGTGGTGCTGGAA
AAACGCTGGCAACATGATTTCTCGTTCTCCGAAAAGAACCTGCGCCTGCATTGTGTGCCGGTGATTAACC
TGTTCCCGCTGGAATCGGACCCGCTGTCACTTTCTTCATTACAGACCGAATACCTGCTGCGCCCAATGCG
CATTCAGGACGGTTATACCGAAGTGTATTCGGTGGACTCGGTGATCTCCTCCCGTCATACCGGGCATCAG
GTCTATGTCCCTTTCACCAGCTTTCGCCACAAGGGGGGGATGTTGCGCCATGATGCGCCGGAGTATTACT
ACCATACGCGGGTCAAACGCGGGCCTTCGGGGTTACACGATACCTGGCTGGTGCTGGGGGGCGAGGCGTT
TGATAACCACAGCGTACCGGATAATGAAAATTTGTCGCTGAGCCTGACCGGCACCAACGGGCAGTTACCG
CGTAAAGCGCTGCAAAGCACGGTGCTGGATACGGCGGTGAAATCCACCGGGGCTCAGGTGCGGGTGCGTA
ATCTCTCCGCGCCGTCATTGCCATGCTACCCGCCGAACCGCGACCGTTTTCACTGGCGGGTGCTGAGCCA
TCTGGGCAGTAGTTTTCTGTGGATGATGGATAACGCCGAAGTGCTGCGCGGCACGCTGGCGCTGTATGAC
TGGACGGACAACGAAATGAACCGCCGTCGGCTGGAGGCGATCGCCGAGGTCAAACACAGCGAGATTGAAC
GCTTTGAGCGGGGCTATTTGCTGCGCGGGGTGCACATTGAAATCACCCTCGACAGCAACGGCTTTACCGG
TACCGGGGATATTTGTCTGTTTGGGGAAATGCTCAGTCGCTTCTTTGCCCTGTATACCGATATTCACCTG
TTTAATCGTCTGACTCTGATACTGCAACCGACAGGAGAACGTTTGGAATGGGAAGAGAATCATCAGTCCC
GCCTTCCCGGCTAA