SecReT6
Protein ID: 384416367
SecReT6 ID592
T6SS typei3
Gene symbol-
Locus tagYPC_4012
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]3871208..3871768 [+]
Producthypothetical protein
NoteTssB
UniProt IDE8P2Q7
KEGG IDyph:YPC_4012
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.00E-57, Aligned region: 11..165
Protein Sequence: 186 a.a.     [Download]
>gi|384416367|ref|YP_005625729.1| hypothetical protein YPC_4012 [Yersinia pestis biovar Medievalis str. Harbin 35]
MAKDASSQKFIGRNNAPRVQIEYDVEIYGSNKKVELPFVTGVMADLSGHRAKPLPAVEDRKFLTFDQDNF
DARMRAIKPRLKFYVDNTLSEDNELLDIELDFESMDDFSPGSLARRIPQMEKLLEARTHLAELITYMDGK
TSAEEVVKQLLEQPDFLQNLATDAQGTISKLSQDDDVLVEDDDGEK
 
Nucleotide Sequence: 561 bp     [Download]
>gi|384412706|ref|NC_017265.1|:3871208-3871768 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGGCCAAAGATGCGAGCTCGCAAAAATTTATCGGTAGAAATAATGCACCTAGAGTGCAAATTGAATATG
ACGTCGAAATTTATGGTTCAAATAAGAAAGTAGAGTTGCCTTTTGTAACCGGCGTGATGGCTGATCTTTC
TGGCCACAGAGCAAAGCCTCTTCCTGCTGTTGAAGATCGTAAATTCCTTACTTTCGATCAGGATAATTTC
GATGCCCGGATGAGAGCAATTAAGCCTCGCCTTAAATTCTACGTAGATAACACCTTGAGTGAGGATAACG
AACTCCTGGATATCGAACTGGATTTTGAGTCAATGGATGACTTTTCCCCCGGATCGTTAGCGCGGCGTAT
TCCTCAAATGGAAAAACTGCTTGAGGCACGCACCCATCTGGCTGAATTGATCACCTATATGGATGGTAAA
ACCAGCGCAGAAGAGGTGGTTAAACAACTGCTTGAACAACCTGATTTTTTACAAAATCTTGCGACCGATG
CACAGGGAACTATTTCGAAGCTCAGCCAGGATGATGATGTTTTAGTGGAAGATGACGATGGAGAAAAATA
G