SecReT6
Protein ID: 384416368
SecReT6 ID592
T6SS typei3
Gene symbol-
Locus tagYPC_4013
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]3871768..3873279 [+]
Producthypothetical protein
NoteTssC
UniProt IDE8P2Q8
KEGG IDyph:YPC_4013
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.00E-184, Aligned region: 69..495
Protein Sequence: 503 a.a.     [Download]
>gi|384416368|ref|YP_005625730.1| hypothetical protein YPC_4013 [Yersinia pestis biovar Medievalis str. Harbin 35]
MENMQKAQLNDTPDINVDLAENELDDILKRSFRPRTDEASATVRRAIGTLAAYANKGQVKVNRDVVLTIE
SLVAEIDEKLSDQMNLILHHKEFQKLESAWRGLSYLVDNTDANETLKIRVLNISQDELGKTLRRYRGSAW
DQSPIFKQVYEHEYGQFGGEPFGCMIGDYEFDHSPQSVALLTELAKVAAAAHCPFITSSSPSIMQMNNWR
ELGNPRDIGKIFTTPEYAPWRRLRESNDSRYLVLTLPRFLSRLPYGAKNHPIDDFAFEEVVSPHASEDFT
WANAAYAMGVNINRAFNEYGWCSRIRGIESGGSVEELPAYAFPSDEGGYELTCPTELAISDRRENELSNA
GFLPLVYRKNSDFAAFIGSCTLHAPANYDDPDATANARLSARLPYIFATCRFAHYLKCIVRDKIGSFRSR
DDMQLWLNDWVMNYVDGDPSISTEATKAKRPLAAAEVQVEDVEDDPGFYRAHFYLRPHYQLEGMTVSLRL
VSKLPSNKESEKK
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|384412706|ref|NC_017265.1|:3871768-3873279 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
GTGGAGAACATGCAGAAAGCCCAACTCAATGACACGCCAGACATCAACGTCGATCTGGCTGAAAACGAGT
TAGATGACATTTTAAAACGTTCTTTTCGCCCTCGAACTGACGAAGCTTCCGCCACAGTGCGCCGTGCCAT
AGGCACGCTTGCTGCGTATGCCAATAAAGGCCAAGTGAAAGTCAATCGTGATGTCGTACTGACCATTGAG
TCTTTAGTCGCTGAAATTGACGAAAAACTTTCCGATCAAATGAACCTTATTCTGCACCATAAAGAGTTCC
AAAAGCTGGAATCAGCTTGGCGCGGGCTTAGCTATCTTGTTGATAATACAGATGCTAATGAAACTTTAAA
AATACGGGTACTGAACATTAGCCAAGATGAACTGGGGAAAACGCTTCGCCGTTATCGTGGCTCTGCATGG
GATCAAAGTCCGATATTTAAACAGGTCTATGAACATGAATATGGGCAGTTTGGTGGGGAACCTTTTGGTT
GCATGATCGGTGATTATGAATTCGATCACAGTCCACAGAGTGTGGCTCTGCTGACCGAGTTAGCCAAGGT
GGCCGCCGCCGCTCACTGTCCTTTCATTACCTCTTCTTCCCCAAGCATCATGCAGATGAATAACTGGAGG
GAGCTGGGTAACCCAAGGGATATCGGCAAAATCTTTACCACACCTGAATATGCGCCATGGAGACGTTTAC
GTGAGAGTAATGACTCCCGCTATCTGGTACTGACTCTGCCACGTTTTCTTTCGCGTCTGCCGTATGGTGC
CAAAAATCATCCTATTGATGATTTTGCTTTTGAAGAAGTGGTTAGCCCTCATGCCAGTGAGGATTTCACC
TGGGCGAATGCGGCCTATGCCATGGGCGTCAATATTAACCGGGCCTTCAATGAATATGGTTGGTGTTCAA
GGATCCGCGGTATTGAGTCGGGGGGGTCCGTAGAAGAACTTCCGGCCTATGCTTTTCCTTCTGACGAAGG
CGGATATGAACTCACTTGTCCGACAGAATTGGCAATTTCGGACCGTCGTGAGAACGAGCTATCCAATGCT
GGGTTTTTACCGCTGGTCTACCGTAAGAACTCAGACTTTGCCGCCTTTATCGGGTCGTGCACCCTGCATG
CACCGGCAAACTATGATGACCCCGATGCGACGGCGAACGCCAGATTATCGGCCCGTTTACCTTACATTTT
TGCCACCTGTCGTTTCGCCCATTACCTCAAATGTATTGTGCGCGACAAAATTGGTTCGTTCCGCTCGCGG
GATGACATGCAACTTTGGCTTAACGACTGGGTGATGAACTACGTCGATGGTGACCCCTCCATTTCAACAG
AAGCCACTAAAGCTAAACGCCCGCTGGCCGCTGCGGAAGTTCAAGTTGAAGACGTAGAGGATGATCCTGG
TTTTTACCGCGCTCACTTCTATTTACGCCCTCACTACCAACTTGAAGGTATGACGGTTTCTCTGCGGCTG
GTTTCTAAACTTCCATCCAACAAGGAAAGCGAAAAGAAATAA