SecReT6
Protein ID: 384416370
SecReT6 ID592
T6SS typei3
Gene symbol-
Locus tagYPC_4015
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]3874034..3874477 [+]
Producthypothetical protein
NoteTssE
UniProt IDE8P3A8
KEGG IDyph:YPC_4015
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.70E-14, Aligned region: 23..123
Protein Sequence: 147 a.a.     [Download]
>gi|384416370|ref|YP_005625732.1| hypothetical protein YPC_4015 [Yersinia pestis biovar Medievalis str. Harbin 35]
MDISAPILFDKLSLRHEHVRLPHWREVIVRDIESLLNDSAHSARLKLKKYPHCEASVLNYGLPSLSQQVP
VITDLLELARHIQRIIATFESRLDPRSIKVVPLINKGETWVLAILFDIHARCNLPGEEHLVNLRIALDYS
YGMVRVL
 
Nucleotide Sequence: 444 bp     [Download]
>gi|384412706|ref|NC_017265.1|:3874034-3874477 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGGATATTTCAGCACCGATACTTTTTGACAAATTAAGTCTCCGCCATGAACACGTTCGCTTACCTCATT
GGCGTGAAGTGATTGTGCGCGATATTGAATCTTTATTGAATGACTCCGCACACAGTGCCCGGTTGAAGCT
AAAAAAGTATCCGCATTGTGAGGCTTCTGTATTGAATTACGGGCTGCCTTCGCTCAGTCAGCAGGTACCG
GTAATCACCGACTTGCTGGAACTGGCCAGACATATACAGCGGATCATCGCCACGTTTGAGTCACGCCTGG
ATCCGCGCTCAATAAAAGTGGTGCCGCTGATTAATAAAGGCGAAACCTGGGTGTTAGCCATCCTGTTTGA
CATTCATGCCCGGTGCAACCTACCGGGCGAAGAGCACTTGGTCAATTTACGCATCGCGCTCGATTACTCC
TATGGAATGGTTCGCGTTCTTTAA