SecReT6
Protein ID: 384416734
SecReT6 ID593
T6SS typeN/A
Gene symbol-
Locus tagYPC_4415
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]4274456..4276858 [-]
Productputative Rhs accessory genetic element
NoteTssI
UniProt IDE8P705
KEGG IDyph:YPC_4415
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.80E-70, Aligned region: 194..491
Phage_GPD [PF05954], Evalue: 3.80E-70, Aligned region: 670..701
Phage_base_V [PF04717], Evalue: 1.80E-23, Aligned region: 531..623
Protein Sequence: 800 a.a.     [Download]
>gi|384416734|ref|YP_005626096.1| putative Rhs accessory genetic element [Yersinia pestis biovar Medievalis str. Harbin 35]
MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGIGDAVGGTAGKRINQAAEVAKTALDA
KAKVLDGGVTPTNIVATGPAPTVSGAQMTEMAGGIGDAVGGTAGKRINQAAEVAKTALEAKAKVLDGGVT
PMNLAAGGAGAGLPDSAAAAISRLVKQPSGLQFTLTTASLPPQTFAVVDFTLSEMLSSPFVLNVGLASAD
PAVDFAAVLDEDATLFIWREGVLQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQAS
VEEIITTLLKENGINDFAFGFRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGKNTVVYADDV
GSLPKGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGELQNQRPDYEH
FDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAWQLLGVQHSGK
QMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEYGRIRLQFLWD
RYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNIPPGSLPASKT
QMAFRSKTHKGEGYNEMRFEDAKGGEGLFMHAQKDMTTMVLNDRKTDVTQDHSEHIGQDQSVTVVRNQSN
TIQNDRRVEVTRDQQTEVGNDYQLVVKGEKKEFVTKIRYTEVHEDETLTVTKSIKIHAKQGDISISTPNA
GITITHDGAIVLQGKYIRLAADMIDLNPEE
 
Nucleotide Sequence: 2403 bp     [Download]
>gi|384412706|ref|NC_017265.1|:c4276858-4274456 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGTTTGCTCATGATAAAGCTAATAATAATAAAGCCGCGGACAAGACCGGCACGGTGACGCCGACCCATA
TCGTCTCGCCGGAGGCCGCCCCAACCGTGAGTGGCGCTCAGATGACCGAGATGGCCGGGGGGATTGGGGA
TGCGGTGGGCGGCACTGCCGGTAAGCGCATCAATCAGGCCGCCGAGGTGGCAAAAACCGCCCTGGATGCC
AAAGCAAAAGTACTGGACGGCGGCGTCACGCCGACGAACATTGTGGCCACTGGCCCGGCCCCAACCGTGA
GTGGCGCTCAAATGACCGAGATGGCCGGGGGGATCGGGGATGCGGTGGGCGGTACTGCCGGTAAGCGCAT
TAATCAGGCCGCCGAGGTGGCTAAAACCGCCCTGGAGGCCAAAGCAAAAGTACTGGACGGCGGCGTCACG
CCGATGAATCTGGCCGCGGGCGGGGCCGGTGCGGGATTGCCGGACAGCGCCGCGGCGGCGATATCCCGCC
TGGTCAAACAGCCCTCCGGCCTGCAATTTACCCTGACGACGGCCAGTTTACCGCCCCAGACCTTTGCGGT
GGTGGATTTCACCCTGAGCGAGATGCTCTCCTCGCCGTTTGTGCTCAATGTCGGGCTGGCGAGTGCCGAT
CCGGCGGTGGATTTTGCGGCGGTATTGGATGAAGACGCCACGCTGTTTATCTGGCGCGAAGGGGTACTGC
AACGCAGCATCACCGGCATGGTCGCCAGCTTTGAACAGGGCGATACCGGTTTTCATCAGACCCGCTACAG
CATGGTGATCCGCCCGGCGCTGTGGCGCACCAGCCTGCGGCGCAATGCCCGCATCTTCCAGCAAGCCTCG
GTGGAAGAGATCATCACCACCCTGCTGAAAGAGAACGGCATCAACGATTTTGCTTTTGGTTTTCGCCACC
CGCACCCGGTGCGCGAGTTCTGCGTGCAATATCAGGAGTCCGATTTTGATTTTATCCAGCGCCTGACGGC
AGAAGAGGGGATTTTCTACTACTTCGAGTTCAGCGCCGGGAAAAATACCGTGGTGTATGCCGATGATGTT
GGCTCCCTGCCGAAAGGCGCGTCACTGCCCTATAACCCGAATGTGGCGGCGCAGGCGCAGGAACTGAGTA
TCACCACCTTCACCCGCAGTGCGCAGGTGCGCCCGGCGATGGTGCAACTGAAAGACTACACCTTTAAAAA
CCCGAACTGGGCCGCGGCCTTCAGCGAACAGTCGGGAGAACTGCAAAACCAGCGACCGGACTACGAGCAT
TTTGATTTTCCGGGGCGCTTCAAAGATGCCCAGCACGGGCAGGATTTTACCCGCTACCGGCTGGACGCGC
TGCGCAATGACGCCAATCTGGGGCAGGGGGCGAGCAATGATTTTACCCTCCAGCCGGGGCAGTTGTTCAG
CCTGTACAACCACCCGCGTGGTGATCTGAACCACGCCTGGCAGTTGCTCGGCGTTCAGCACAGCGGCAAA
CAGATGCAGGCGCTGGAGCAGGCGTCTGGCGATCAGGGCACGGTGCTGTTCAACCACTTCAGTTTTATTC
CGCACACCCAGACCTGGCGGCCGACGCCGCTGGCGAAACCGGCGATGGACGGCCCGCAGATCGCCATGGT
GGTGGGGCCACCGGGGGAAGAGATTTACTGCGACGAATACGGGCGCATCCGCCTGCAATTTTTATGGGAT
CGCTACGGGCAGAGCAATGACAACAGCTCCTGCTGGATCCGGGTAACCCAGCCGTGGGCGGGCCAGGGCT
GGGGCATGCTGGCCATTCCGCGTATTGGTCAGGAAGTGGTGGTGGATTTTCTGCACGGCGATCCGGATCA
ACCGATTGTCACGGGGCGGACCTATCACGCCAACAACATCCCGCCGGGGTCGTTACCGGCCAGTAAAACC
CAGATGGCGTTCCGCTCAAAAACCCACAAAGGGGAAGGCTACAACGAAATGCGCTTCGAGGATGCCAAAG
GCGGCGAAGGGCTGTTTATGCATGCGCAGAAAGATATGACGACCATGGTGCTGAATGATCGCAAAACCGA
TGTGACTCAGGACCATTCAGAGCACATTGGGCAAGATCAGTCCGTGACGGTTGTGCGTAACCAAAGTAAT
ACGATCCAAAATGATCGCCGGGTAGAGGTGACTCGCGATCAACAAACCGAAGTGGGCAATGATTACCAGC
TAGTGGTGAAAGGTGAAAAGAAAGAGTTTGTGACGAAAATTCGTTACACCGAAGTGCATGAAGACGAAAC
GCTCACGGTGACGAAAAGTATTAAAATCCATGCCAAACAAGGTGATATCAGCATATCAACCCCGAATGCC
GGAATTACGATCACCCATGACGGTGCCATTGTTCTGCAAGGGAAATACATTCGTTTAGCGGCCGATATGA
TCGATCTTAATCCAGAGGAGTAG