SecReT6
Protein ID: 384416738
SecReT6 ID593
T6SS typeN/A
Gene symbol-
Locus tagYPC_4419
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]4281882..4283270 [-]
Producthypothetical protein
NoteTssA
UniProt IDE8P709
KEGG IDyph:YPC_4419
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.30E-16, Aligned region: 53..112
DUF1020 [PF06255], Evalue: 0.01, Aligned region: 111..144
Protein Sequence: 462 a.a.     [Download]
>gi|384416738|ref|YP_005626100.1| hypothetical protein YPC_4419 [Yersinia pestis biovar Medievalis str. Harbin 35]
MDITSQHPWHVLLQAPLSPEQTAQALADDDPQWEYIDGQMVKLGSLAHATLNIDDIQQQAMALLSQKSKD
FRLVVHLLRTLQHGGQPDELMLAMSLLTEYVQLFWTTAWPQNPLHKRRFAQQILKRFDSASSSFSQRADE
AQRENVQGLLAHLAQVWHSREPGLAKEVDALRSRYARPPERVIEAVASDEPLSSNTLAAAMAATPVSPSL
AIDNTSDRAWRQTLLKMADLLSEQQPDAAIGFRLRRHAVWGALTAPPMAQSDGRTPLAAVSADRTADYLA
RLANADLPLWHQVEQSLTLAPYWLDGHVLSAQIALQLGYDAVAQAIRDELSVFLARIPALKTLFFTDMTP
FLSSESAAWLQQDANHQGRSRTIEQDEIWQCYQQQGLEAALQMINRQPQQSEPRDRFYHQLLSAQLFEKA
GLTALAQQHYHSLLLVGQQLQLSEWEPALIALLTEKQRQLKP
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|384412706|ref|NC_017265.1|:c4283270-4281882 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGGATATCACGTCACAACATCCCTGGCATGTCTTGTTACAAGCCCCTTTGTCACCTGAGCAGACCGCAC
AAGCCCTGGCCGATGATGACCCCCAATGGGAATATATCGACGGCCAGATGGTGAAACTGGGGTCATTGGC
CCACGCCACGCTGAATATTGATGATATTCAGCAACAAGCCATGGCGCTGTTATCACAGAAAAGTAAAGAC
TTCCGGCTCGTGGTGCATCTACTGCGCACCCTACAACACGGGGGCCAGCCAGATGAATTAATGCTGGCGA
TGTCGTTGCTGACCGAATACGTCCAGCTATTTTGGACTACGGCCTGGCCGCAAAATCCTTTACACAAACG
GCGCTTTGCTCAACAAATCCTAAAACGCTTTGACAGCGCCAGCAGCAGTTTTAGCCAACGAGCGGACGAG
GCTCAACGTGAGAATGTGCAAGGATTATTGGCACATTTAGCACAGGTTTGGCATAGCCGTGAGCCGGGTC
TGGCTAAAGAGGTGGATGCATTACGCAGCCGCTATGCGCGGCCACCGGAGCGGGTTATCGAGGCAGTGGC
TTCTGATGAACCGCTCTCATCCAACACCTTGGCGGCGGCAATGGCCGCCACCCCCGTTAGCCCAAGCCTC
GCCATAGATAACACGAGCGACAGAGCCTGGCGGCAGACCTTGCTGAAAATGGCGGATCTACTCAGCGAAC
AGCAACCCGATGCCGCTATCGGTTTCCGGCTACGCCGCCATGCCGTATGGGGCGCGTTAACCGCACCACC
TATGGCGCAGAGCGATGGCCGCACCCCGTTAGCCGCGGTATCTGCGGATCGAACCGCCGATTACTTAGCA
CGTCTGGCTAATGCCGATTTGCCTTTGTGGCACCAAGTGGAGCAGAGCCTCACCCTCGCGCCTTATTGGC
TGGATGGACATGTGCTTTCGGCACAAATCGCCCTGCAACTGGGTTATGACGCGGTGGCACAGGCTATCCG
TGATGAACTCAGCGTTTTTTTAGCCCGTATTCCCGCATTAAAAACCCTCTTTTTTACGGATATGACGCCA
TTCCTCTCCTCTGAATCTGCCGCCTGGTTACAGCAGGATGCGAATCATCAGGGAAGAAGTCGCACTATTG
AACAGGATGAAATTTGGCAATGCTATCAACAGCAAGGATTGGAAGCCGCACTACAGATGATAAACCGGCA
ACCACAGCAATCCGAACCTCGGGACCGTTTTTACCATCAATTGCTCAGTGCACAGTTGTTCGAAAAAGCA
GGGTTAACCGCATTGGCGCAGCAGCACTACCACAGCTTATTACTGGTAGGGCAGCAATTACAGCTAAGCG
AATGGGAACCTGCGTTGATCGCTCTACTGACAGAAAAACAGCGACAACTCAAACCATGA