SecReT6
Protein ID: 384416742
SecReT6 ID593
T6SS typeN/A
Gene symbol-
Locus tagYPC_4423
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]4287367..4288134 [-]
Producthypothetical protein
NoteTssL
UniProt IDE8P713
KEGG IDyph:YPC_4423
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.30E-63, Aligned region: 34..239
Protein Sequence: 255 a.a.     [Download]
>gi|384416742|ref|YP_005626104.1| hypothetical protein YPC_4423 [Yersinia pestis biovar Medievalis str. Harbin 35]
MKTDAVTDNTPFPAAEAVTSHRQYQLPLRGESLNAMIDTATPLLGMVLRLKDMENQALPDQLYQQVVTDI
RAIEQYLQTKGYEPGAIISFRYVLCTFIDETALGHGWNTQNGWLQQSLLVHFHNETWGGEKVYVLLERLM
GEPKRYQDLLEFIYLCFCLGYRGRYKVTSQNGDDFERLFRRLHHQLQQLRGDAPPTVLYQGGGRLNSRYH
LSKRLTIKHLLWGGVSLLVVIYLFYAIHLHTQSQDILQQLNNLLS
 
Nucleotide Sequence: 768 bp     [Download]
>gi|384412706|ref|NC_017265.1|:c4288134-4287367 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGAAAACAGATGCTGTGACTGACAACACCCCTTTCCCCGCAGCGGAAGCGGTCACCTCCCATCGGCAGT
ATCAGCTACCGCTACGTGGCGAAAGCTTGAACGCGATGATCGATACCGCCACCCCATTATTGGGGATGGT
ACTGCGCCTGAAAGACATGGAAAACCAAGCGTTACCGGACCAGCTATATCAGCAGGTGGTGACGGATATC
CGTGCTATTGAGCAGTACTTGCAAACCAAAGGCTACGAACCCGGCGCAATCATATCTTTCCGATATGTGC
TGTGCACATTCATCGATGAAACGGCATTAGGGCATGGCTGGAACACCCAAAACGGTTGGTTACAGCAATC
TCTGTTGGTGCATTTTCATAATGAAACCTGGGGCGGAGAGAAAGTGTACGTCCTGCTGGAACGCTTAATG
GGGGAACCCAAGCGTTACCAAGACCTGCTGGAGTTTATCTATCTCTGTTTTTGTTTGGGTTACCGCGGCC
GCTACAAAGTGACATCACAAAACGGTGATGACTTTGAGCGATTGTTCCGCCGATTGCATCATCAATTACA
GCAGTTACGGGGTGATGCGCCGCCGACGGTCCTTTATCAAGGGGGCGGTCGTCTGAATAGCCGCTACCAC
TTGAGTAAACGGTTGACTATCAAGCATTTGTTATGGGGTGGCGTGAGTCTGCTGGTGGTGATTTATCTGT
TTTATGCCATCCACCTGCACACCCAAAGTCAGGATATTTTGCAACAGCTAAACAATTTATTGAGCTAG