SecReT6
Protein ID: 384416744
SecReT6 ID593
T6SS typeN/A
Gene symbol-
Locus tagYPC_4425
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]4289483..4290028 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDE8P715
KEGG IDyph:YPC_4425
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.60E-36, Aligned region: 17..174
Protein Sequence: 181 a.a.     [Download]
>gi|384416744|ref|YP_005626106.1| putative lipoprotein [Yersinia pestis biovar Medievalis str. Harbin 35]
MNNARGYLLTWALCVVFLLSGCSGAWEATKKVGKVVMDPDIPVGQATDQPSTVRLTLLSDPDTNPNEKGE
AVPTEIVVVYLSENSKLLAADYDQLSSDALEKTLGKNYIDHQEYTLLPDQFKALDPIKLEEKNSYLGVIA
HYADANRSEWKKIIKIKGIGHNYQVLVHVRSNDVDLRKEEE
 
Nucleotide Sequence: 546 bp     [Download]
>gi|384412706|ref|NC_017265.1|:c4290028-4289483 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGAACAACGCCAGAGGCTATCTCCTGACGTGGGCATTATGTGTGGTGTTCCTGTTGTCTGGGTGCAGCG
GTGCATGGGAAGCCACTAAAAAGGTCGGCAAGGTGGTTATGGACCCTGATATTCCGGTGGGGCAGGCTAC
CGATCAACCCTCAACGGTCAGGCTAACATTGCTGTCCGATCCCGATACCAACCCTAATGAAAAAGGGGAA
GCGGTACCGACTGAGATAGTGGTGGTGTACCTAAGTGAAAACTCCAAGCTGCTGGCCGCGGATTATGATC
AGCTAAGCAGTGACGCGTTGGAGAAAACGCTGGGTAAGAATTACATCGATCATCAGGAATACACCTTACT
GCCCGATCAATTCAAGGCGCTGGACCCTATCAAGCTGGAAGAGAAAAACAGCTATCTGGGGGTGATTGCT
CACTATGCCGATGCCAACCGCAGTGAATGGAAGAAGATCATCAAAATAAAAGGGATCGGCCATAACTACC
AGGTTTTGGTCCATGTCAGATCAAACGATGTCGATCTAAGGAAAGAGGAAGAATAA