SecReT6
Protein ID: 384416745
SecReT6 ID593
T6SS typeN/A
Gene symbol-
Locus tagYPC_4426
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]4290028..4290153 [-]
Producthypothetical protein
NoteFha
UniProt IDE8P716
KEGG IDyph:YPC_4426
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 41 a.a.     [Download]
>gi|384416745|ref|YP_005626107.1| hypothetical protein YPC_4426, partial [Yersinia pestis biovar Medievalis str. Harbin 35]
MYKNYYNELASSRQQGFEKLFGEVYEQAYDRALRQGMKDSE
 
Nucleotide Sequence: 126 bp     [Download]
>gi|384412706|ref|NC_017265.1|:c4290153-4290028 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGTACAAAAACTACTATAACGAGCTGGCCTCCAGCCGCCAGCAAGGTTTTGAAAAACTGTTTGGCGAAG
TGTATGAGCAAGCCTATGACCGGGCCTTACGTCAAGGCATGAAGGATAGCGAGTAA