SecReT6
Protein ID: 384416746
SecReT6 ID593
T6SS typeN/A
Gene symbol-
Locus tagYPC_4427
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]4290042..4291343 [-]
Producthypothetical protein
NoteFha
UniProt IDE8P717
KEGG IDyph:YPC_4427
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.0046, Aligned region: 34..100
FHA [PF00498], Evalue: 0.0046, Aligned region: 224..239
Protein Sequence: 433 a.a.     [Download]
>gi|384416746|ref|YP_005626108.1| hypothetical protein YPC_4427 [Yersinia pestis biovar Medievalis str. Harbin 35]
MDKKQPTLSLRVVNSDKLESGKQASSLFHTQGGSVGSDGSHHWSIQDQGGNISPSQFAIEWRDGSFCLRM
LNGSLNINHSMLTPNSGFVRLQQGDEMTLGNLVIKSHISRSAADMIDPLMVSPESLVSSYSNPMDAMMEG
EPLASPHHQQDSRLAATVSHNFSHDPLRVLETESLTTQGHDAVISDADHSLQQDRYRNPLFSSPLSDTPK
DSAMDQAFIDLPQISTFLNGKQAGGKPEGLNNQMEQHHVAITPLMRGFDAQLPIRNSQEAHDFLEEAGKT
LKATIEGLLALQRSQHGLRDKHLRPIEDNPLRLNMDYDTTLNLMFADQKSPVHLSAPAAVAESLDNLRLH
HQANQQAITQALNTMLEAFSPERLLTRFTHYLRSNERQEQDSAWRGICTKTTITSWPPAASKVLKNCLAK
CMSKPMTGPYVKA
 
Nucleotide Sequence: 1302 bp     [Download]
>gi|384412706|ref|NC_017265.1|:c4291343-4290042 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGGATAAAAAACAACCAACGCTGTCATTGCGGGTCGTCAACAGCGATAAATTAGAGAGTGGCAAACAAG
CCAGCAGCCTGTTTCATACGCAAGGGGGCAGTGTCGGCAGTGACGGTAGCCATCATTGGTCGATTCAGGA
CCAAGGCGGCAATATCAGCCCGTCACAGTTTGCTATTGAATGGCGTGATGGCTCTTTCTGCCTGCGGATG
CTGAATGGCTCTCTGAACATTAATCATTCGATGCTGACACCCAATTCGGGTTTCGTTCGCCTACAGCAAG
GGGATGAAATGACGTTGGGTAATCTGGTGATCAAAAGCCATATCAGCCGTTCTGCTGCCGATATGATCGA
TCCACTGATGGTGTCACCGGAGTCACTGGTATCGAGTTACAGCAACCCGATGGATGCCATGATGGAAGGG
GAGCCGTTGGCCTCGCCTCATCATCAGCAAGACAGCCGGTTAGCCGCGACGGTTAGCCATAATTTCAGCC
ATGATCCATTGCGGGTATTGGAAACTGAAAGCCTGACCACGCAAGGCCATGACGCCGTGATATCTGATGC
TGATCACTCTCTACAGCAGGACCGATACCGTAACCCACTTTTCTCTTCCCCGCTCTCTGATACCCCCAAG
GACAGTGCTATGGATCAGGCGTTTATCGATCTCCCGCAGATCAGTACCTTTCTTAACGGTAAACAAGCGG
GGGGCAAACCAGAAGGATTAAATAACCAAATGGAACAACATCACGTTGCCATTACGCCGCTGATGCGTGG
TTTTGACGCTCAACTCCCGATCCGCAACAGCCAGGAAGCTCACGATTTCCTTGAAGAGGCGGGTAAAACA
CTCAAAGCGACAATCGAAGGTCTGCTCGCCTTACAACGCAGCCAACATGGCTTGCGTGATAAGCACTTAC
GGCCGATTGAAGATAATCCATTGCGTCTGAATATGGATTACGACACCACCCTCAACTTGATGTTTGCCGA
TCAAAAAAGCCCGGTTCATCTTTCAGCGCCCGCCGCCGTGGCCGAAAGCCTGGATAACCTGCGTTTGCAT
CATCAGGCCAATCAACAGGCGATTACGCAAGCCTTGAACACCATGTTGGAAGCCTTCTCCCCTGAGCGTT
TACTGACGCGTTTTACCCATTATTTGCGCAGTAATGAGCGGCAAGAGCAGGACTCCGCCTGGCGTGGGAT
ATGTACAAAAACTACTATAACGAGCTGGCCTCCAGCCGCCAGCAAGGTTTTGAAAAACTGTTTGGCGAAG
TGTATGAGCAAGCCTATGACCGGGCCTTACGTCAAGGCATGA