SecReT6
Protein ID: 384416747
SecReT6 ID593
T6SS typeN/A
Gene symbol-
Locus tagYPC_4428
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]4291469..4292566 [-]
Producthypothetical protein
NoteTssG
UniProt IDE8P718
KEGG IDyph:YPC_4428
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.50E-93, Aligned region: 41..351
Protein Sequence: 365 a.a.     [Download]
>gi|384416747|ref|YP_005626109.1| hypothetical protein YPC_4428 [Yersinia pestis biovar Medievalis str. Harbin 35]
MLRMAGTDRSTCTDVSVVEDVSGVENVNGVEARPEGQALDVSRYNFFQLVELLNQLAVAWQGAAPVATPA
NEAIRFKSTASLAFPTRDVIALDTSARGQFELEVSFLGLHGSQSPLPGYYLDSLAWEDAQNENRLTDFMN
VFNHRLLTLLHQIWRKYRYYICFDNGGDDAFSQRMFSLVGLGSEVVRNKLQINHSKMLAYAGLLASPGRA
PEVICSLVSHCFNLPDITLHSWQLRKVDIAPSQQNRLGTRVKVRGKKYDEKSVLGVNFSIGSRVADRSGK
FLLCINKLTREQFLSFLPNGANYASLVMFVAFIMRDQFAWDLRLGLAEQQVGGMVLGTEQNSLLGWTSIL
GDPEQKPSVTIGVME
 
Nucleotide Sequence: 1098 bp     [Download]
>gi|384412706|ref|NC_017265.1|:c4292566-4291469 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGTTACGAATGGCCGGTACAGACAGGTCAACATGCACTGATGTAAGTGTGGTTGAGGATGTAAGTGGGG
TTGAGAATGTAAATGGGGTTGAGGCAAGACCCGAAGGGCAGGCATTGGATGTTTCACGTTATAACTTTTT
TCAATTGGTCGAATTGCTCAACCAATTGGCGGTAGCGTGGCAAGGTGCGGCCCCTGTGGCGACCCCAGCC
AATGAAGCCATCCGTTTTAAATCGACCGCCAGTTTAGCATTCCCGACCAGAGATGTGATCGCACTGGACA
CCTCCGCCCGAGGTCAATTTGAGTTAGAGGTCTCTTTCCTTGGATTGCATGGCAGCCAATCGCCGCTACC
AGGATATTACCTCGATTCGTTAGCGTGGGAGGATGCGCAGAATGAGAACCGGCTAACGGATTTCATGAAC
GTATTCAACCACCGCCTGTTAACGCTACTGCATCAGATTTGGCGTAAATACCGTTACTACATCTGCTTTG
ACAATGGCGGTGATGATGCATTTTCACAACGCATGTTCTCGCTGGTGGGGTTAGGTAGCGAGGTCGTCCG
CAATAAATTGCAGATCAATCACAGCAAAATGCTGGCTTATGCAGGGCTGCTGGCCAGCCCCGGCAGAGCA
CCTGAAGTGATTTGCAGCCTTGTCTCACATTGCTTCAATTTGCCAGATATCACCTTACACAGTTGGCAGC
TACGCAAAGTGGATATTGCCCCCTCACAGCAGAATCGCTTGGGGACGAGGGTGAAAGTCCGTGGCAAGAA
ATATGATGAAAAATCAGTGCTTGGCGTTAATTTCTCCATCGGTTCACGGGTTGCGGATCGTAGCGGGAAA
TTCTTGTTGTGCATCAATAAGCTGACGCGAGAACAGTTCTTATCCTTTTTACCCAACGGGGCTAATTACG
CCTCGTTAGTGATGTTTGTCGCCTTCATTATGCGCGATCAATTCGCGTGGGATTTACGCCTTGGGTTGGC
CGAGCAACAGGTGGGCGGGATGGTGTTGGGAACCGAGCAAAATAGCCTATTGGGCTGGACCAGTATCCTC
GGCGATCCCGAACAGAAACCCAGCGTAACGATTGGTGTAATGGAATAA