SecReT6
Protein ID: 384416748
SecReT6 ID593
T6SS typeN/A
Gene symbol-
Locus tagYPC_4429
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]4292521..4293264 [-]
Producthypothetical protein
NoteTssF
UniProt IDE8P719
KEGG IDyph:YPC_4429
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-73, Aligned region: 4..247
Protein Sequence: 247 a.a.     [Download]
>gi|384416748|ref|YP_005626110.1| hypothetical protein YPC_4429 [Yersinia pestis biovar Medievalis str. Harbin 35]
MHRGHGREYTSFESFHHQIEHSQEKTALYYRLRVKNSLFRKGFEHYISFVRSDESKLVLAEENVSVSLTC
TNRELPLSLRVGDINQLSTDSPSFATFRNITRPSVPLYPVLDGGLHWSLLSNMSLNYMSLLDKDALKQIL
HTYDFPSLHNRQSARASQKKLDAIQRIETQPIDRLFRGLPVRGLQTTLWLEQGAFSSEGELYLFSTVLAR
FFSLYASVNAFHLLKVINLDNQECYEWPVQTGQHALM
 
Nucleotide Sequence: 744 bp     [Download]
>gi|384412706|ref|NC_017265.1|:c4293264-4292521 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
GTGCACCGGGGTCATGGCCGGGAGTACACCTCGTTTGAGAGCTTCCACCATCAGATCGAACACTCGCAAG
AAAAGACCGCACTTTATTACCGCCTACGTGTGAAAAATTCATTATTCCGTAAGGGATTCGAACACTACAT
TTCCTTTGTTCGCAGTGATGAATCGAAGCTGGTGCTTGCTGAAGAGAATGTCTCGGTCAGCCTGACGTGC
ACCAACCGTGAGTTGCCGCTGTCGTTGCGCGTTGGTGATATCAATCAACTCAGCACAGACAGCCCTTCAT
TCGCGACGTTCCGCAATATTACCCGTCCTTCCGTGCCGTTGTATCCGGTGCTGGATGGGGGCCTGCATTG
GTCATTGCTCTCCAATATGTCGTTGAACTACATGTCCTTACTGGATAAGGACGCGTTGAAGCAAATTCTG
CATACCTATGATTTCCCAAGCCTGCATAACCGGCAATCAGCCAGGGCATCGCAAAAGAAACTGGACGCTA
TCCAACGTATTGAAACACAACCGATTGACCGGTTGTTTCGTGGCTTACCTGTCAGAGGGCTACAAACCAC
GCTATGGCTGGAGCAAGGCGCTTTTAGCTCTGAAGGCGAGCTTTATCTCTTCAGCACGGTATTAGCTCGC
TTCTTCTCACTGTATGCCAGCGTCAATGCGTTTCATCTTTTAAAAGTCATCAATCTTGATAATCAGGAAT
GTTACGAATGGCCGGTACAGACAGGTCAACATGCACTGATGTAA