SecReT6
Protein ID: 384418307
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1315
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1289818..1292643 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDG7THB2
KEGG IDxor:XOC_1315
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.30E-61, Aligned region: 41..355
Phage_GPD [PF05954], Evalue: 1.30E-61, Aligned region: 852..898
DUF2345 [PF10106], Evalue: 1.00E-36, Aligned region: 749..907
T6SS_Vgr [PF13296], Evalue: 3.00E-34, Aligned region: 584..690
T6SS_Vgr [PF13296], Evalue: 3.00E-34, Aligned region: 849..870
Phage_base_V [PF04717], Evalue: 1.20E-23, Aligned region: 50..65
Phage_base_V [PF04717], Evalue: 1.20E-23, Aligned region: 427..524
NAGLU_N [PF12971], Evalue: 0.0093, Aligned region: 175..197
NAGLU_N [PF12971], Evalue: 0.0093, Aligned region: 842..893
Protein Sequence: 941 a.a.     [Download]
>gi|384418307|ref|YP_005627667.1| Rhs element Vgr protein [Xanthomonas oryzae pv. oryzicola BLS256]
MMEALNALMFQGALLSDSGRLYRLQLPGGDVQVVERWSGSERLSGGFEWWVDVLSTQAGLPLEAWLGRRA
TLYTRLADGDESPRTGLIHDAYALGSDGGLARYRVGLVPWTWWLSQGRHSRVFQERTLVQIVEAVFADYA
PMASWQWSEETSAFLGQARPRSYCVQYRESDLDFVQRLLAEEGLGWRLQEAAPSPGGHQLVVFADSTAQP
QDPSSAQGGGLRYHRSDATEAADSVLAIGATRRLGSGRLTVLSEDFKTRQARSAQLPLHGGGRQSLREVY
EPVGMDAFASAQAADRSAELMAQAHEAQWSPWQGRSTVRTLRAGTWFTLTQSPQQGQAPPAQLLLTRVWH
AGINNLPVDVRAAVQSQLGAAPAWPDASAVAARSTWAQAEAVGYGNAFEAVDRQQPWRPVLADGTGARLH
PRPTAPGSQSAIVVGADGSTGGSQEVHADALGRIRVRFHFQHAASAPAAQDSTWLRVAQRYAGPGVGSQF
LPRIGQEVLVGFLEGDIDRPVVLGALYNGKGEAGVPATPGGSSAEADTGLYAKAGDGRPSAQGNLAGGHA
PAWHGAGGGADNHRNATALWGVQSKEWGGAGHSRLVFDDSDQQLRLQLATTQAATQLNLGHLIHQADNYR
GSFRGEGFELRTDAWGAVRASSGLWLSSYGRSGGPAGEATQPSALLSQLQTLGKTFSQAAGTHQTVKLAA
HEGVGQANHSQLIAEQAPLPALLTSVKTTVPGTAYADAKGAAAERRASPGDDRVPHTGDALLGLAAPAGI
GVVAGQGLSWSVGETLTLASGAGSEAAIAGDARLHSGQAIGVLAAAVDGGQTQAHSLSLVSGEGALDVQA
QSDDVRVQSKEGLKLISANADVALAAGKTLHLAVAGGASVTIEGGNITVACPGTITVHASKKSFVGPVQQ
AYPLPAFAKSVCIPCLLQAMGKGHALSPVNG
 
Nucleotide Sequence: 2826 bp     [Download]
>gi|384417079|ref|NC_017267.1|:1289818-1292643 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
GTGATGGAAGCACTGAATGCGTTGATGTTTCAGGGGGCCTTGCTGTCCGACAGCGGTCGCCTATACCGCT
TGCAGCTGCCTGGCGGGGATGTCCAGGTGGTGGAGCGCTGGAGCGGGTCGGAACGGCTGAGCGGCGGTTT
TGAGTGGTGGGTGGACGTGCTGAGCACGCAGGCGGGCTTGCCGCTGGAGGCGTGGCTGGGGCGGCGCGCG
ACGCTGTACACCCGGCTGGCCGATGGCGATGAAAGCCCGCGCACGGGGCTGATCCACGACGCGTACGCCC
TGGGCAGCGACGGCGGGCTGGCGCGCTACCGGGTAGGCCTGGTGCCGTGGACGTGGTGGTTGTCGCAGGG
CCGGCACAGCCGGGTGTTCCAGGAACGCACGCTGGTGCAGATCGTGGAAGCGGTATTCGCCGACTACGCG
CCGATGGCGAGCTGGCAGTGGAGCGAGGAGACGAGCGCGTTCCTGGGGCAGGCGCGGCCGCGCAGCTACT
GCGTGCAGTACCGCGAGAGCGACCTGGATTTCGTGCAGCGGTTATTGGCCGAGGAAGGGCTGGGCTGGCG
GCTGCAGGAGGCGGCCCCGTCGCCCGGCGGGCACCAGCTGGTGGTGTTCGCCGACAGCACCGCGCAACCG
CAGGACCCCAGTTCGGCGCAGGGCGGCGGGCTGCGCTACCACCGCAGCGACGCCACCGAGGCGGCCGACA
GCGTGCTGGCGATTGGCGCCACCCGGCGGCTGGGCAGCGGCCGGCTGACGGTGCTCAGCGAAGACTTCAA
GACGCGCCAGGCGCGCAGCGCGCAGTTGCCGTTGCACGGCGGCGGCAGGCAGTCGCTGCGCGAGGTGTAC
GAGCCGGTGGGGATGGACGCCTTCGCCAGCGCGCAGGCAGCAGACCGCTCTGCGGAGTTGATGGCGCAGG
CGCACGAGGCGCAGTGGTCACCGTGGCAGGGCCGCAGCACGGTGCGCACGCTGCGCGCCGGCACCTGGTT
CACGCTGACCCAGTCACCGCAGCAGGGCCAGGCACCGCCGGCGCAGCTGTTGCTGACGCGGGTGTGGCAT
GCGGGTATCAACAACTTGCCGGTGGACGTGCGCGCGGCGGTGCAGTCGCAGTTGGGGGCCGCGCCGGCGT
GGCCGGACGCCAGCGCGGTGGCCGCACGCAGCACCTGGGCGCAGGCCGAGGCGGTGGGCTACGGCAACGC
CTTCGAGGCGGTGGACCGGCAGCAGCCGTGGCGGCCGGTGCTGGCCGACGGCACCGGTGCGCGGCTGCAC
CCGCGGCCGACCGCGCCGGGCTCCCAGAGCGCCATCGTGGTCGGTGCCGATGGCAGCACCGGCGGCAGCC
AGGAGGTCCATGCCGACGCGCTGGGCCGGATCCGGGTCAGGTTCCACTTCCAGCACGCCGCGTCGGCCCC
GGCCGCGCAGGACAGCACGTGGCTGCGGGTGGCGCAGCGCTACGCTGGCCCGGGCGTGGGCAGCCAGTTC
CTGCCGCGCATCGGCCAGGAAGTGCTGGTGGGCTTCCTGGAGGGGGACATCGACCGTCCGGTGGTGCTGG
GGGCGCTGTACAACGGCAAGGGCGAAGCCGGCGTTCCCGCCACCCCCGGCGGCAGCAGCGCCGAGGCCGA
CACCGGCCTGTACGCCAAGGCCGGCGACGGCAGACCCAGCGCGCAGGGCAACCTGGCCGGCGGCCATGCC
CCGGCCTGGCACGGTGCCGGCGGCGGCGCGGACAACCACCGCAACGCCACCGCGCTGTGGGGCGTGCAAT
CCAAGGAATGGGGCGGCGCTGGCCACAGCCGGCTGGTGTTCGACGACAGCGACCAGCAACTGCGCTTGCA
ACTGGCGACCACCCAGGCAGCCACGCAACTGAACCTGGGGCACCTGATCCACCAGGCCGACAACTACCGC
GGCAGCTTCCGCGGGGAAGGCTTCGAACTGCGCACCGACGCGTGGGGCGCGGTGCGTGCCAGCTCGGGGC
TATGGCTGAGCAGCTACGGCCGCAGCGGCGGCCCGGCCGGCGAGGCGACCCAGCCCAGCGCATTGCTGAG
CCAGCTGCAGACGCTGGGCAAGACGTTCTCGCAGGCGGCGGGCACGCACCAGACGGTGAAGCTGGCCGCG
CACGAAGGCGTGGGCCAGGCGAACCACTCCCAGCTGATCGCCGAGCAGGCGCCGCTGCCGGCGCTGCTGA
CCAGCGTGAAGACCACGGTGCCGGGCACGGCCTACGCCGACGCCAAGGGCGCGGCGGCCGAGCGCCGCGC
CAGCCCGGGCGACGACCGGGTGCCGCACACCGGCGATGCGCTGCTGGGCCTGGCCGCACCAGCGGGGATC
GGCGTGGTGGCCGGCCAGGGCCTGAGCTGGAGCGTGGGCGAGACGCTGACGCTGGCCAGCGGCGCGGGCA
GCGAAGCGGCCATCGCCGGCGACGCCCGGCTGCACAGCGGCCAGGCAATCGGCGTGCTGGCCGCGGCGGT
GGACGGCGGGCAAACGCAGGCGCACAGCCTGAGCCTGGTCAGCGGCGAAGGCGCGCTGGACGTGCAGGCG
CAGTCAGACGACGTGCGCGTGCAGTCGAAAGAAGGGCTGAAGCTGATCAGCGCCAACGCCGACGTGGCAC
TGGCGGCGGGCAAGACCCTCCACCTGGCGGTGGCCGGCGGGGCCAGCGTGACCATCGAAGGCGGCAACAT
CACCGTCGCCTGCCCCGGCACCATCACCGTGCATGCGAGCAAGAAGTCGTTTGTGGGGCCGGTGCAGCAG
GCGTATCCGTTGCCCGCGTTCGCAAAGTCGGTCTGCATCCCGTGCCTGTTGCAGGCCATGGGCAAGGGGC
ACGCGTTGTCCCCGGTGAATGGGTGA