SecReT6
Protein ID: 384418318
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1326
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1302900..1305188 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDG7THC3
KEGG IDxor:XOC_1326
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 9.10E-36, Aligned region: 515..524
DUF2345 [PF10106], Evalue: 9.10E-36, Aligned region: 571..729
T6SS_Vgr [PF13296], Evalue: 2.10E-34, Aligned region: 406..512
T6SS_Vgr [PF13296], Evalue: 2.10E-34, Aligned region: 671..693
Phage_base_V [PF04717], Evalue: 2.60E-24, Aligned region: 249..346
Phage_GPD [PF05954], Evalue: 9.80E-20, Aligned region: 1..177
Phage_GPD [PF05954], Evalue: 9.80E-20, Aligned region: 674..721
Protein Sequence: 762 a.a.     [Download]
>gi|384418318|ref|YP_005627678.1| Rhs element Vgr protein [Xanthomonas oryzae pv. oryzicola BLS256]
MAEEGLGWRLQEAAPSPGGHQLVVFADSTAQPQDPSSAQGGGLRYHRSDATEAADSVLAIGATRRLGSGR
LTVLSEDFKTRQARSAQLPLHGGGRQSLREVYEPVGMDAFASAQAADRSAELMAQAHEAQWSPWQGRSTV
RTLRAGTWFTLTQAPQQGQAPPAQLLLTRVWHAGINNLPVDVRAAVQSQLGAAPAWPDASAVAARSTWAQ
AEAVGYGNAFEAVDRQQPWRPVLADGTGARLHPRPTAPGSQSAIVVGADGSTGGSQEVHADALGRIRVRF
HFQHAASAPAAQDSTWLRVAQRYAGPGVGSQFLPRIGQEVLVGFLEGDIDRPVVLGALYNGKGEAGVPAT
PGGTSAEADTGLYAKAGDGRPSAQGNLAGGHAPAWHGAGGGADNHRNATALWGVQSKEWGGAGHSRLVFD
DSDQQLRLQLATTQAATQLNLGHLIHQADNYRGSFRGEGFELRTDAWGAVRASSGLWLSSYGRSGGPAGE
ATQPSALLSQLQTLGKTFSQAAGTHQTVKLAAHEGVGQANHSQLIAEQAPLPALLTSVKTTVPGTAYADA
KGAAAERRASPGDDRVPHTGDALLGLAAPAGIGVVAGQGLSWSVGETLTLASGAGSEAAIAGDARLHSGQ
AIGVLAAAVDGGQTQAHSLSLVSGEGALDVQAQSDDVRVQSKEGLKLISANADVALAAGKTLHLAVAGGA
SVTIEGGNITVACPGTITVQASKKSFVGPVNLGYGLPLFPESVCVECMLKAAAKGSPFAALQ
 
Nucleotide Sequence: 2289 bp     [Download]
>gi|384417079|ref|NC_017267.1|:1302900-1305188 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
TTGGCCGAGGAAGGGCTGGGCTGGCGGCTGCAGGAGGCGGCCCCGTCGCCCGGCGGGCACCAGCTGGTGG
TGTTCGCCGACAGCACCGCGCAACCGCAGGACCCCAGTTCGGCGCAGGGCGGCGGGCTGCGCTACCACCG
CAGCGACGCCACCGAGGCGGCCGACAGCGTGCTGGCGATTGGCGCCACCCGGCGGCTGGGCAGCGGCCGG
CTGACGGTGCTCAGCGAAGACTTCAAGACGCGTCAGGCGCGCAGCGCGCAGTTGCCGTTGCACGGCGGCG
GCAGGCAGTCGCTGCGCGAGGTGTACGAGCCGGTGGGGATGGACGCCTTCGCCAGCGCGCAGGCAGCAGA
CCGCTCTGCGGAGTTGATGGCGCAGGCGCACGAGGCGCAGTGGTCACCGTGGCAGGGCCGCAGCACGGTG
CGCACGCTGCGCGCCGGCACCTGGTTCACGCTGACCCAGGCACCGCAGCAGGGCCAGGCGCCGCCGGCGC
AGCTGTTGCTGACGCGGGTGTGGCATGCGGGTATCAACAACTTGCCGGTGGACGTGCGCGCGGCGGTGCA
GTCGCAGTTGGGGGCCGCGCCGGCGTGGCCGGACGCCAGCGCGGTGGCCGCACGCAGCACCTGGGCGCAG
GCCGAGGCGGTGGGCTACGGCAACGCCTTCGAGGCGGTGGACCGGCAGCAGCCGTGGCGGCCGGTGCTGG
CCGACGGCACCGGTGCGCGGCTGCACCCGCGGCCGACCGCGCCGGGCTCCCAGAGCGCCATCGTGGTCGG
TGCCGATGGCAGCACCGGCGGCAGCCAGGAGGTCCATGCCGACGCGCTGGGCCGGATCCGGGTCAGGTTC
CACTTCCAGCACGCCGCGTCGGCCCCGGCCGCGCAGGACAGCACGTGGCTGCGGGTGGCGCAGCGCTACG
CCGGCCCGGGCGTGGGCAGCCAGTTCCTGCCGCGCATCGGCCAGGAAGTGCTGGTGGGCTTCCTGGAGGG
GGACATCGACCGTCCGGTGGTGCTGGGGGCGCTGTACAACGGCAAGGGCGAAGCCGGCGTTCCCGCCACC
CCCGGCGGCACCAGCGCCGAGGCCGACACCGGCCTGTACGCCAAGGCCGGCGACGGCAGACCCAGCGCGC
AGGGCAACCTGGCCGGCGGCCATGCCCCGGCCTGGCACGGTGCCGGCGGCGGCGCGGACAACCACCGCAA
CGCCACCGCGCTGTGGGGCGTGCAATCCAAGGAATGGGGCGGCGCTGGCCACAGCCGGCTGGTGTTCGAC
GACAGCGACCAGCAATTGCGCTTGCAACTGGCGACCACCCAGGCAGCCACGCAACTGAACCTGGGGCACC
TGATCCACCAGGCCGACAACTACCGCGGCAGCTTCCGCGGGGAAGGCTTCGAACTGCGCACCGACGCGTG
GGGCGCGGTGCGGGCCAGCTCGGGGCTATGGCTGAGCAGCTACGGCCGCAGCGGCGGCCCGGCCGGCGAG
GCGACCCAGCCCAGCGCATTGCTGAGCCAGCTGCAGACGCTGGGCAAGACGTTCTCGCAGGCGGCGGGCA
CGCACCAGACGGTGAAGCTGGCCGCGCACGAAGGCGTGGGCCAGGCGAACCACTCCCAGCTGATCGCCGA
GCAGGCACCGCTGCCGGCGCTGCTGACCAGCGTGAAGACCACGGTGCCGGGCACGGCCTACGCCGACGCC
AAGGGCGCGGCGGCCGAGCGCCGCGCCAGCCCGGGCGACGACCGGGTGCCGCACACCGGCGATGCGCTGC
TGGGCCTGGCCGCACCAGCGGGGATCGGCGTGGTGGCCGGCCAGGGCCTGAGCTGGAGCGTGGGCGAGAC
GCTGACGCTGGCCAGCGGCGCGGGCAGCGAAGCGGCCATCGCCGGCGACGCCCGGCTGCACAGCGGCCAG
GCAATCGGCGTGCTGGCCGCGGCGGTGGACGGCGGGCAAACGCAGGCGCACAGCCTGAGCCTGGTCAGCG
GCGAAGGCGCGCTGGACGTGCAGGCGCAGTCGGACGACGTGCGCGTGCAGTCGAAAGAAGGCCTGAAGCT
GATCAGCGCCAACGCCGACGTGGCACTGGCGGCGGGCAAGACCCTCCACCTGGCGGTGGCCGGCGGGGCC
AGCGTGACCATCGAAGGCGGCAACATCACCGTCGCCTGCCCCGGCACCATCACCGTGCAGGCGAGCAAGA
AGTCGTTTGTGGGGCCGGTCAACTTGGGATATGGCCTACCGCTATTCCCCGAATCTGTGTGCGTCGAATG
CATGCTCAAGGCGGCGGCTAAGGGCTCCCCGTTTGCGGCACTGCAATGA