SecReT6
Protein ID: 384418319
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1327
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1305230..1307545 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDG7THC4
KEGG IDxor:XOC_1327
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.80E-57, Aligned region: 42..342
Phage_GPD [PF05954], Evalue: 5.80E-57, Aligned region: 600..633
T6SS_Vgr [PF13296], Evalue: 8.00E-29, Aligned region: 515..621
Phage_base_V [PF04717], Evalue: 2.50E-16, Aligned region: 386..495
Protein Sequence: 771 a.a.     [Download]
>gi|384418319|ref|YP_005627679.1| Rhs element Vgr protein [Xanthomonas oryzae pv. oryzicola BLS256]
MDIPTLAVALASLAQPSQHARLIQLRAPVEGLVVERFHGQEAVCGATLLQIACLATSAFLDAEALLEQPL
DLQLRQADGTQRHWQGLCTEVAQLGGDGGLARYRLTLAPWTALLELRRNALVFQDLDARAICERIFADYP
QAAFRFDVQAALPAHPITTQYRETDWAFVTRLLAEAGLAWRYAHAQDADSQATAATLVIFDPQAQVPDSG
TIRFHRSDLAEADDAIGAFGERRGVVPTASTVTSWHSEQVRAVGAQAQAEAGGLPPLEVYVQPRAGRFAQ
EATAQDQAQARLDALRVPHTLHAGAGSARVLAAGAAFTLRQHAQHDGQRFVPVAIEHVAVNNLGQGIVAL
LDAPELEHGSYRNRFLAVPAATPLRALPQDRPRMPGPQSARVVGVADAALSPSRDHQVRIQFPWQRGDQP
TPGGLTDSASTAPGHAPGDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEVLVEFLHGDIDQPRITGQLYNG
ELAPPFGGGLDAHASHPGTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRLHTSLADTRLELGYLVQHSDTA
RGALRGQGFELASQGRGNVHAAQGLLLSSSACGQGASTALDVAEAVAQLHGAQRTAQALHATLTQQQVPG
LDAHPSMTRLREAIDPQAQGKYTAAVGGQAATTPADGGRDGGTLRPGAPARRVAGPHRLDHPGQRGGLCR
AGPAVDRAAGCAAERRADPVGGVRPAHRAVRPTRTDQTHRRRRPGEPASTYRRAGTAGRPGGDRHRHRHP
R
 
Nucleotide Sequence: 2316 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c1307545-1305230 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGGATATCCCGACGCTGGCCGTCGCCCTGGCTAGTCTGGCGCAGCCGTCCCAACATGCCCGCCTGATCC
AACTGCGCGCCCCGGTCGAGGGGCTGGTGGTGGAACGCTTCCACGGGCAGGAGGCGGTGTGCGGCGCCAC
CCTGCTGCAGATCGCGTGCCTGGCCACCTCGGCGTTTCTCGATGCCGAGGCGCTGCTGGAGCAGCCACTG
GACCTGCAGCTGCGCCAGGCCGACGGCACGCAACGCCACTGGCAGGGCCTGTGCACCGAAGTGGCGCAAC
TGGGCGGCGACGGCGGCCTGGCCCGCTACCGGCTGACCCTGGCGCCGTGGACGGCGCTGCTGGAGCTGCG
GCGCAACGCACTGGTGTTCCAGGACCTGGACGCGCGCGCGATTTGCGAACGGATCTTCGCCGACTACCCG
CAGGCCGCGTTCCGCTTCGACGTGCAGGCCGCGTTGCCGGCGCACCCGATCACCACCCAATACCGCGAGA
CCGACTGGGCCTTCGTCACCCGCCTGCTGGCCGAGGCCGGCCTGGCCTGGCGCTACGCGCACGCGCAGGA
CGCCGACAGCCAGGCCACCGCGGCCACGCTGGTGATCTTCGACCCGCAGGCGCAGGTGCCGGACAGCGGC
ACGATCCGCTTCCACCGCAGCGACCTGGCCGAGGCCGACGATGCGATCGGCGCCTTCGGCGAGCGCCGCG
GCGTCGTGCCCACCGCCAGCACGGTGACCAGCTGGCACAGCGAACAAGTGCGCGCGGTCGGCGCGCAGGC
CCAGGCCGAGGCCGGCGGGCTGCCGCCGCTGGAGGTCTACGTGCAGCCGCGCGCCGGGCGTTTCGCCCAG
GAAGCGACAGCGCAGGATCAGGCGCAGGCGCGGCTGGACGCGCTGCGCGTGCCGCACACGCTGCACGCCG
GGGCCGGCAGCGCCCGCGTGCTGGCGGCCGGGGCGGCGTTCACCTTGCGCCAGCACGCCCAGCACGACGG
CCAGCGTTTCGTTCCGGTGGCGATCGAGCACGTGGCGGTGAACAACCTGGGCCAGGGCATCGTCGCCCTG
CTGGACGCGCCGGAGCTGGAGCACGGCAGCTACCGCAACCGCTTCCTGGCGGTGCCGGCGGCCACGCCGC
TGCGCGCGCTGCCGCAGGACCGCCCGCGCATGCCCGGGCCGCAGAGCGCGCGCGTGGTCGGCGTGGCCGA
CGCGGCGCTGAGCCCGAGCCGCGACCACCAGGTGCGGATCCAGTTCCCGTGGCAGCGCGGCGACCAGCCC
ACCCCGGGCGGGTTGACCGACAGCGCCAGCACCGCGCCCGGCCACGCGCCGGGCGACCAGCGCGCCGGCA
CCTGGGTGCCGGTGGCCGAGTGGGTGGCCGGCCCGAACTGGGGCAGCCACTTCCTGCCGCGCATCGGCAG
CGAAGTGCTGGTGGAGTTCCTGCACGGAGACATCGATCAGCCGCGCATCACCGGCCAGTTGTACAACGGC
GAGCTCGCCCCACCCTTCGGCGGCGGCCTGGACGCGCATGCCAGCCACCCCGGCACGCTCAGCGGCCTGC
ACACCCAGTCCCACGACGGCAGCGGCACCCAGCAATGGCTGCTGGACGACACCCCCGGCCAGCTGCGCAC
GCGCCTGCACACCTCGCTGGCCGACACCCGGCTGGAACTGGGCTACCTGGTCCAGCACAGCGACACCGCC
CGCGGCGCGCTGCGCGGCCAGGGCTTCGAACTGGCCTCCCAGGGCCGGGGCAACGTGCATGCCGCGCAAG
GCCTGCTGCTGTCCAGCAGCGCCTGCGGCCAGGGCGCCTCGACCGCATTGGACGTGGCCGAGGCGGTGGC
CCAGTTGCACGGCGCCCAACGCACCGCTCAGGCGCTGCACGCCACCCTGACCCAGCAACAGGTGCCCGGC
CTGGACGCCCATCCCAGCATGACCCGGCTGCGCGAGGCCATCGACCCGCAAGCGCAGGGCAAGTACACCG
CTGCGGTCGGCGGCCAGGCGGCGACCACGCCGGCCGACGGCGGCCGCGACGGTGGAACGCTTCGCCCAGG
CGCGCCTGCTCGGCGAGTCGCCGGACCACATCGCCTGGACCACCCCGGCCAGCGCGGTGGCCTATGCCGG
GCAGGCCCTGCAGTTGACCGTGCAGCAGGATGCGCAGCTGAGCGCCGGGCAGACCCTGTCGGCGGTGTCC
GGCCAGCACACCGCGCTGTTCGCCCAACGCGGACCGATCAAACTCATCGCCGCCGCCGGCCCGGTGAGCC
TGCAAGCACATACCGGCGCGCTGGAACTGCTGGCCGACCAGGCGGTGACCGTCACCGCCACCGACACCCG
CGCTAG