SecReT6
Protein ID: 384418320
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1328
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1307556..1308347 [-]
Producthypothetical protein
NoteTssL
UniProt IDG7THC5
KEGG IDxor:XOC_1328, xor:XOC_1338
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.80E-56, Aligned region: 33..234
Protein Sequence: 263 a.a.     [Download]
>gi|384418320|ref|YP_005627680.1| hypothetical protein XOC_1328 [Xanthomonas oryzae pv. oryzicola BLS256]
MMNPLPPTPGPMPSLTAQAPHGLASAHPSTPQSLLDLMADGFYLLLLLKRAQIPSDTESFVQSVQTFLDG
VERGAVKLGIASEDIYAAKYAFCAAVDEAILSQPSALHETWERNPLQLRLFGEHLAGEHFFDRLEELRRQ
GAVRLPSLEIYHYCLLLGFEGKYRLEGPEKLGYLTARLGDEIIYFKGKRSGFAPHWPPPDNVRHALRRVV
PLWLPTALVTGFGLLGFFGLRLSLDHQTERRMAAYNQVVQMPQRTAHITITLP
 
Nucleotide Sequence: 792 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c1308347-1307556 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGATGAACCCGCTGCCCCCCACCCCCGGCCCGATGCCGTCGCTGACCGCGCAGGCGCCGCACGGCCTGG
CCAGCGCCCATCCCTCCACGCCGCAGAGCCTGCTCGACCTGATGGCCGACGGCTTCTACCTGCTGCTGCT
GCTCAAGCGCGCGCAGATACCCAGCGACACCGAATCCTTCGTGCAGTCGGTGCAGACATTCCTCGATGGC
GTGGAACGCGGCGCAGTCAAGCTCGGCATCGCCTCCGAGGACATCTACGCGGCCAAATACGCGTTCTGCG
CGGCAGTGGACGAAGCGATCCTGTCGCAGCCCTCGGCACTGCACGAAACCTGGGAACGCAATCCGCTGCA
GCTGCGCCTGTTCGGCGAGCACCTGGCCGGCGAGCATTTCTTCGATCGCCTGGAAGAGCTGCGCCGCCAG
GGCGCCGTGCGCCTGCCCTCGCTGGAGATCTACCACTATTGCCTGCTGCTTGGCTTCGAAGGCAAGTATC
GGCTGGAAGGGCCGGAGAAGCTCGGCTACCTGACCGCGCGGCTGGGCGACGAGATCATCTATTTCAAGGG
CAAGCGCAGCGGTTTCGCACCGCATTGGCCGCCGCCGGACAACGTGCGCCATGCCTTGCGCCGTGTGGTG
CCGCTGTGGCTGCCGACCGCGCTGGTGACCGGCTTCGGCCTGCTCGGCTTCTTCGGTCTGCGCCTGTCTC
TGGACCACCAGACCGAGCGGCGCATGGCCGCCTACAACCAGGTGGTGCAGATGCCGCAACGCACCGCGCA
CATTACAATCACTCTGCCGTGA