SecReT6
Protein ID: 384418321
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1329
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1308344..1309234 [-]
Producthypothetical protein
NoteTssK
UniProt IDG7TI04
KEGG IDxor:XOC_1339, xor:XOC_1329
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.00E-97, Aligned region: 2..294
Protein Sequence: 296 a.a.     [Download]
>gi|384418321|ref|YP_005627681.1| hypothetical protein XOC_1329 [Xanthomonas oryzae pv. oryzicola BLS256]
MKLLTDDTPRDPYVTVPVARVRRTPTGGFELDEDFIPSCAHIDASPTLYRELRGLLDSLQAKVDALYGLH
RQSSQHIIEFRSGDIASFWLLHTACSSFGALSHLFHHPQLHPERLYQELLRMAGALLTFSNAYQLNDLPR
YNHAAPEACFQRLFQIVRDLLDTVISARYFKIALTEVKPSFHLGRIDSQRIDENAAFYLSVSADMPGPEL
VQTVPVRFKIGAPDDVEKCVLSALPGVKLTHAAQVPAAIPVRPGSYYFALEARGPLYERMLKAQSMMLYV
PSGIDDLKMELVAVTS
 
Nucleotide Sequence: 891 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c1309234-1308344 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
GTGAAGCTGCTCACCGACGACACTCCGCGCGATCCGTACGTGACCGTGCCGGTGGCGCGCGTGCGCCGTA
CCCCAACCGGCGGCTTCGAGCTGGACGAGGACTTCATCCCGTCATGCGCGCACATCGACGCCTCGCCGAC
GCTGTATCGCGAACTGCGCGGCCTGCTCGACTCGCTGCAGGCTAAGGTCGATGCGCTGTACGGGCTGCAT
CGGCAATCGTCGCAGCACATCATCGAATTCCGCTCCGGCGACATCGCCTCGTTCTGGCTGCTGCATACCG
CCTGTTCCTCGTTCGGCGCGCTGTCGCACCTGTTCCATCATCCGCAGCTGCACCCCGAGCGCCTGTACCA
GGAACTGCTGCGCATGGCCGGCGCGTTGCTGACGTTCTCCAACGCCTACCAGCTCAACGACCTGCCCCGG
TACAACCACGCGGCGCCGGAAGCCTGCTTCCAGCGCCTGTTCCAGATCGTGCGCGACCTGCTCGACACGG
TGATCTCGGCGCGCTACTTCAAGATCGCGCTGACCGAGGTCAAGCCGTCGTTCCACCTGGGCCGGATCGA
TTCGCAGCGGATCGACGAGAACGCCGCGTTCTACCTGAGCGTGTCGGCCGACATGCCCGGGCCGGAACTG
GTGCAGACGGTGCCGGTGCGGTTCAAGATCGGTGCGCCGGACGACGTCGAGAAGTGCGTGCTGTCGGCCC
TGCCGGGCGTGAAACTGACCCACGCCGCGCAGGTGCCGGCAGCGATCCCGGTCCGTCCCGGCAGCTACTA
TTTCGCCCTGGAAGCGCGCGGGCCGCTGTACGAGCGCATGCTCAAGGCGCAGTCTATGATGCTCTATGTG
CCGTCAGGCATTGATGACCTCAAGATGGAACTTGTCGCGGTGACCTCATGA