SecReT6
Protein ID: 384418334
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1342
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1327175..1328854 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDG7TI07
KEGG IDxor:XOC_1342
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 3.30E-49, Aligned region: 197..230
DUF2345 [PF10106], Evalue: 3.30E-49, Aligned region: 284..436
T6SS_Vgr [PF13296], Evalue: 1.20E-30, Aligned region: 132..238
T6SS_Vgr [PF13296], Evalue: 1.20E-30, Aligned region: 315..335
Phage_base_V [PF04717], Evalue: 1.10E-15, Aligned region: 3..112
Sarcoglycan_1 [PF04790], Evalue: 0.0073, Aligned region: 365..418
Protein Sequence: 559 a.a.     [Download]
>gi|384418334|ref|YP_005627694.1| Rhs element Vgr protein [Xanthomonas oryzae pv. oryzicola BLS256]
MPGPQSARVVGVADAALSPSRDHQVRIQCPWQRGDQPTPGGLTDSASTAPGHAPGDQRAGTWVPVAEWVA
GPNWGSHFLPRIGSEVLVEFLHGDIDQPRITGQLYNGELAPPFGGGLDARAGHPGTLSGLHTQSHDGSGT
QQWLLDDTPGQLRTRLHTSLADTRLELGYLVQHSDTARGALRGQGFELASQGWGNVHAAQGLLLSSSARG
QGASTALDVAEAVAQLHGAQRTAQALHATLTQQQVPGLDAHPSVTRLREAIDPQAQGKYTAAVGGQAATK
PGDGGRDGQAPVERFAQARLLGESPDHIAWTTPASAVAYAGQALQLTVQQDAQLSAGQTLSAVSGQHTAL
FAQRGPIKLIAAAGPVSLQAHTGALELLADQAVTITATDTRIDVLAQHKIVLQAGQTRITLEGGDITFAC
PGQFTVKASMHPFLGGEMKTVAIPTLPEERLPLQTLSLDHRYHDDQGLAGADYVVILADGGKRHGTLDAQ
GRAEVANVPGGSAEVVFSPMPGLFGRKDMTPTPDHAANPADAKLDGVVDKYLAAATADAVKADPVKGVQ
 
Nucleotide Sequence: 1680 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c1328854-1327175 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGCCCGGGCCGCAGAGCGCGCGCGTGGTCGGCGTGGCCGACGCGGCGCTGAGCCCGAGCCGCGACCACC
AGGTGCGGATCCAGTGCCCGTGGCAGCGCGGCGACCAGCCCACCCCGGGCGGGTTGACCGACAGCGCCAG
CACCGCGCCCGGCCACGCGCCGGGCGACCAGCGCGCCGGCACCTGGGTGCCGGTGGCCGAGTGGGTGGCC
GGCCCGAACTGGGGCAGCCACTTCCTGCCGCGCATCGGCAGCGAAGTGCTGGTGGAGTTCCTGCACGGGG
ACATCGATCAGCCGCGCATCACCGGCCAGTTGTACAACGGCGAGCTCGCCCCACCCTTCGGCGGCGGCCT
GGACGCGCGCGCCGGCCACCCCGGCACGCTCAGCGGCCTGCACACCCAGTCCCACGACGGCAGCGGCACC
CAGCAATGGCTGCTGGACGACACCCCCGGCCAGCTGCGCACGCGCCTGCACACCTCGCTGGCCGACACCC
GGCTGGAACTGGGCTACCTGGTCCAGCACAGCGACACCGCCCGCGGCGCGCTGCGCGGCCAGGGCTTCGA
ACTGGCCTCCCAGGGCTGGGGCAACGTGCATGCCGCGCAAGGCCTGCTGCTGTCCAGCAGCGCCCGCGGC
CAGGGCGCCTCGACCGCATTGGACGTGGCCGAGGCGGTGGCCCAGTTGCACGGCGCCCAACGCACCGCCC
AGGCGCTGCACGCCACCCTGACCCAGCAACAGGTGCCCGGCCTGGACGCCCATCCCAGCGTGACCCGGCT
GCGCGAGGCCATCGACCCGCAGGCGCAGGGCAAGTACACCGCTGCGGTCGGCGGCCAGGCGGCGACCAAG
CCGGGCGACGGCGGCCGCGACGGCCAGGCACCGGTGGAACGCTTCGCCCAGGCGCGCCTGCTCGGCGAGT
CGCCGGACCACATCGCCTGGACCACCCCGGCCAGCGCGGTGGCCTATGCCGGGCAGGCCCTGCAGTTGAC
CGTGCAGCAGGATGCGCAGCTGAGCGCCGGGCAGACCCTGTCGGCGGTGTCCGGCCAGCACACCGCGCTG
TTCGCCCAACGCGGACCGATCAAACTCATCGCCGCCGCCGGCCCGGTGAGCCTGCAGGCGCACACCGGCG
CGCTGGAACTGCTGGCCGACCAGGCGGTGACCATCACCGCCACCGACACCCGCATCGACGTGCTGGCGCA
GCACAAGATCGTGCTGCAGGCCGGACAGACCCGCATCACCCTGGAAGGCGGCGACATCACCTTCGCCTGC
CCGGGGCAGTTCACGGTCAAGGCCAGCATGCATCCGTTCTTGGGTGGGGAGATGAAGACCGTCGCCATCC
CGACGCTGCCGGAAGAACGCCTTCCCCTGCAAACGCTGTCGCTCGATCATCGCTACCACGACGATCAGGG
CCTGGCAGGTGCCGATTACGTGGTCATCCTGGCCGATGGCGGCAAACGGCACGGCACGCTCGACGCGCAA
GGGCGCGCCGAGGTGGCGAATGTCCCCGGCGGCTCGGCCGAGGTGGTGTTCTCGCCGATGCCGGGCCTGT
TCGGCCGCAAGGACATGACGCCCACGCCCGATCACGCGGCCAATCCTGCCGACGCAAAGCTGGACGGCGT
GGTAGACAAGTATCTGGCCGCCGCCACCGCCGATGCCGTTAAAGCCGATCCCGTTAAAGGAGTGCAGTGA