SecReT6
Protein ID: 384418340
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1348
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1335400..1337937 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDG7TI13
KEGG IDxor:XOC_1348
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.40E-57, Aligned region: 41..342
Phage_GPD [PF05954], Evalue: 4.40E-57, Aligned region: 618..774
Phage_GPD [PF05954], Evalue: 4.40E-57, Aligned region: 785..811
DUF2345 [PF10106], Evalue: 2.20E-49, Aligned region: 233..286
DUF2345 [PF10106], Evalue: 2.20E-49, Aligned region: 580..613
DUF2345 [PF10106], Evalue: 2.20E-49, Aligned region: 667..821
T6SS_Vgr [PF13296], Evalue: 2.20E-30, Aligned region: 515..621
T6SS_Vgr [PF13296], Evalue: 2.20E-30, Aligned region: 698..718
Phage_base_V [PF04717], Evalue: 2.70E-16, Aligned region: 386..495
Protein Sequence: 845 a.a.     [Download]
>gi|384418340|ref|YP_005627700.1| Rhs element Vgr protein [Xanthomonas oryzae pv. oryzicola BLS256]
MDIPTLAVALASLAQPSQHARLIQLRAPVEGLVVERFHGQEAVCGATVLQIACLATSAFLDAEALLEQPL
DLQLRQADGTQRHWQGLCTEVAQLGGDGGLARYRLTLAPWTALLELRRNALVFQDLDARAICERIFADYP
QAAFRFDVQAALPAHPITTQYRETDWAFVTRLLAEAGLAWRYAHAQDADSQATAATLVIFDPQAQVPDSG
TIRFHRSDLAEADDAIGAFGERRGVVPTASTVTSWHSEQVRAVGAQAQAEAGGLPPLEVYVQPRAGRFAQ
EATAQDQAQARLDALRVPHTLHAGAGSARVLAAGAAFTLRQHAQHDGQRFVPVAIEHVAVNNLGQGIVAL
LDAPELEHGSYRNRFLAVPAATPLRALPQDRPRMPGPQSARVVGVADAALSPSRDHQVRIQFPWQRGDQP
TPGGLTDSASTAPGHAPGDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEVLVEFLHGDIDQPRITGQLYNG
ELAPPFGGGLDARAGHPGTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRLHTSLADTRLELGYLVQHSDTA
RGALRGQGFELASQGWGNVHAAQGLLLSSSARGQGASTALDVAEAVAQLHGAQRTAQALHATLTQQQVPG
LDAHPSVTRLREAIDPQAQGKYTAAVGGQAATTPADGGRDGQAPVERFAQARLLGESPDHIAWTTPASAV
AYAGQALQLTVQQDAQLSAGQTLSAVSGQHTALFAQRGPIKLIAAAGPVSLQAHTGALELLADQAVTITA
TDTRIDVLAQHKIVLQAGQTRITLEGGDITFACPGQFTVKASTHPFLGGESGNPQFALPDGLVHLEPDRM
LDFSG
 
Nucleotide Sequence: 2538 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c1337937-1335400 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGGATATCCCGACACTGGCCGTCGCCCTGGCTAGTCTGGCGCAGCCGTCCCAACATGCCCGCCTGATCC
AACTGCGCGCCCCGGTCGAGGGGCTGGTGGTGGAACGCTTCCACGGGCAGGAGGCGGTGTGCGGCGCCAC
CGTGCTGCAGATCGCGTGCCTGGCCACCTCGGCGTTTCTCGATGCCGAGGCGCTGCTGGAGCAGCCACTG
GACCTGCAGCTGCGCCAGGCCGACGGCACGCAACGCCACTGGCAGGGCCTGTGCACCGAAGTGGCGCAAC
TGGGCGGCGACGGCGGCCTGGCCCGCTACCGGCTGACCCTGGCGCCGTGGACGGCGCTGCTGGAGCTGCG
GCGCAACGCACTGGTGTTCCAGGACCTGGACGCGCGCGCGATTTGCGAACGGATCTTCGCCGACTACCCG
CAGGCCGCGTTCCGCTTCGACGTGCAGGCCGCGTTGCCGGCGCACCCGATCACCACCCAATACCGCGAGA
CCGACTGGGCCTTCGTCACCCGCCTGCTGGCCGAGGCCGGCCTGGCCTGGCGCTACGCGCACGCGCAGGA
CGCCGACAGCCAGGCCACCGCGGCCACGCTGGTGATCTTCGACCCGCAGGCGCAGGTGCCGGACAGCGGC
ACGATCCGCTTCCACCGCAGCGACCTGGCCGAGGCCGACGATGCGATCGGCGCCTTCGGCGAGCGCCGCG
GCGTCGTGCCCACCGCCAGCACGGTGACCAGCTGGCACAGCGAACAAGTGCGCGCGGTCGGCGCGCAGGC
CCAGGCCGAGGCCGGCGGGCTGCCGCCGCTGGAGGTCTACGTGCAGCCGCGCGCCGGGCGTTTCGCCCAG
GAAGCGACAGCGCAGGATCAGGCGCAGGCGCGGCTGGACGCGCTGCGCGTGCCGCACACGCTGCACGCCG
GGGCCGGCAGCGCCCGCGTGCTGGCGGCCGGGGCGGCGTTCACCTTGCGCCAGCACGCCCAGCACGACGG
CCAGCGTTTCGTTCCGGTGGCGATCGAGCACGTGGCGGTGAACAACCTGGGCCAGGGCATCGTCGCCCTG
CTGGACGCGCCGGAGCTGGAGCACGGCAGCTACCGCAACCGCTTCCTGGCGGTGCCGGCGGCCACGCCGC
TGCGCGCGCTGCCGCAGGACCGCCCGCGCATGCCCGGGCCGCAGAGCGCGCGCGTGGTCGGCGTGGCCGA
CGCGGCGCTGAGCCCGAGCCGCGACCACCAGGTGCGGATCCAGTTCCCGTGGCAGCGCGGCGACCAGCCC
ACCCCGGGCGGGTTGACCGACAGCGCCAGCACCGCGCCCGGCCACGCGCCGGGCGACCAGCGCGCCGGCA
CCTGGGTGCCGGTGGCCGAGTGGGTGGCCGGCCCGAACTGGGGCAGCCACTTCCTGCCGCGCATCGGCAG
CGAAGTGCTGGTGGAGTTCCTGCACGGGGACATCGATCAGCCGCGCATCACCGGCCAGTTGTACAACGGC
GAGCTCGCCCCACCCTTCGGCGGCGGCCTGGACGCGCGCGCCGGCCACCCCGGCACGCTCAGCGGCCTGC
ACACCCAGTCCCACGACGGCAGCGGCACCCAGCAATGGCTGCTGGACGACACTCCCGGCCAGCTGCGCAC
GCGCCTGCACACCTCGCTGGCCGACACCCGGCTGGAACTGGGCTACCTGGTCCAGCACAGCGACACCGCC
CGCGGCGCGCTGCGCGGCCAGGGCTTCGAACTGGCCTCCCAGGGCTGGGGCAACGTGCATGCCGCGCAAG
GCCTGCTGCTGTCCAGCAGCGCCCGCGGCCAGGGCGCCTCGACCGCATTGGACGTGGCCGAGGCGGTGGC
CCAGTTGCACGGCGCCCAACGCACCGCCCAGGCGCTGCACGCCACCCTGACCCAGCAACAGGTGCCCGGC
CTGGACGCCCATCCCAGCGTGACCCGGCTGCGCGAGGCCATCGACCCGCAAGCGCAGGGCAAGTACACCG
CTGCGGTCGGCGGCCAGGCGGCGACCACGCCGGCCGACGGCGGCCGCGACGGCCAGGCACCGGTGGAACG
CTTCGCCCAGGCGCGCCTGCTCGGCGAGTCGCCGGACCACATCGCCTGGACCACCCCGGCCAGCGCGGTG
GCCTATGCCGGGCAGGCCCTGCAGTTGACCGTGCAGCAGGATGCGCAGCTGAGCGCCGGGCAGACCCTGT
CGGCGGTGTCCGGCCAGCACACCGCGCTGTTCGCCCAACGCGGACCGATCAAACTCATCGCCGCCGCCGG
CCCGGTGAGCCTGCAGGCGCACACCGGCGCGCTGGAACTGCTGGCCGACCAGGCGGTGACCATCACCGCC
ACCGACACCCGCATCGACGTGCTGGCGCAGCACAAGATCGTGCTGCAGGCCGGACAGACCCGCATCACCC
TGGAAGGCGGCGACATCACCTTCGCCTGCCCGGGGCAGTTCACGGTCAAGGCCAGCACGCATCCGTTCTT
GGGTGGGGAGAGCGGCAACCCCCAATTCGCCTTGCCCGATGGGCTGGTGCATCTGGAACCAGACCGCATG
CTCGATTTCTCGGGCTGA