SecReT6
Protein ID: 384418341
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1349
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1337948..1338739 [-]
Producthypothetical protein
NoteTssL
UniProt IDG7TI14
KEGG IDxor:XOC_1349
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-56, Aligned region: 33..234
Protein Sequence: 263 a.a.     [Download]
>gi|384418341|ref|YP_005627701.1| hypothetical protein XOC_1349 [Xanthomonas oryzae pv. oryzicola BLS256]
MMNPLPPTPGPMPSLTAQAPHGLASAHPSTPQSLLDLMADGFYLLLLLKRAQIPSDTESFVQSVQTFLDG
VERGAVKLGIASEDIYAAKYAFCAAVDEAILSQPSALHETWERNPLQLRLFGEHLAGEHFFDRLEELRRQ
GAVRLPSLEIYHYCLLLGFEGKYRLEGPEKLGYLTARLGDEIIYFKGKRSGFAPHWPPPDNVRHALRRVV
PLWLPAALVTGFGLLGFFGLRLSLDHQTEQRMAAYNQVVQMPQRTAHITITLP
 
Nucleotide Sequence: 792 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c1338739-1337948 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGATGAACCCGCTGCCCCCCACCCCCGGCCCGATGCCGTCGCTGACCGCGCAGGCGCCGCACGGCCTGG
CCAGCGCCCATCCCTCCACGCCGCAGAGCCTGCTCGACCTGATGGCCGACGGCTTCTACCTGTTGCTGCT
GCTCAAGCGCGCGCAGATACCCAGCGACACCGAATCCTTCGTGCAGTCGGTGCAGACATTCCTCGATGGC
GTGGAACGCGGCGCAGTCAAGCTCGGCATCGCCTCCGAGGACATCTACGCGGCCAAATACGCGTTCTGCG
CGGCAGTGGACGAAGCGATCCTGTCGCAGCCCTCGGCACTGCACGAAACCTGGGAACGCAATCCGCTGCA
GCTGCGCCTGTTCGGCGAACACCTGGCCGGCGAGCATTTCTTCGATCGCCTGGAAGAGCTGCGCCGCCAG
GGCGCCGTGCGCCTGCCCTCGCTGGAGATCTACCACTATTGCCTGCTGCTTGGCTTCGAAGGCAAGTATC
GGCTGGAAGGGCCGGAGAAGCTCGGCTACCTGACCGCGCGGCTGGGCGACGAGATCATCTATTTCAAGGG
CAAGCGCAGCGGTTTCGCACCGCATTGGCCGCCGCCGGACAACGTGCGCCATGCCTTGCGCCGTGTGGTA
CCGCTGTGGCTGCCGGCCGCGCTGGTGACCGGCTTCGGCCTGCTCGGCTTCTTCGGTCTGCGCCTGTCTC
TGGACCACCAGACCGAGCAGCGCATGGCCGCCTACAACCAGGTGGTGCAGATGCCGCAACGCACCGCGCA
CATTACAATCACTCTGCCGTGA