SecReT6
Protein ID: 384418342
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1350
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1338736..1340070 [-]
Producthypothetical protein
NoteTssK
UniProt IDG7TI15
KEGG IDxor:XOC_1350
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-138, Aligned region: 16..442
Protein Sequence: 444 a.a.     [Download]
>gi|384418342|ref|YP_005627702.1| hypothetical protein XOC_1350 [Xanthomonas oryzae pv. oryzicola BLS256]
MSKVFWGEGLFLRPQHFQRQDTYHEARLQDLAQTLHPYGWGTRRIRFDPQSMASGSLRALALSVVFPDGE
SYDAPAHDALPDALSLNDLPAGIQTTTVYLALPLLRDDGGNCSDAEGSQLARYQQLNRPTSDLYTDAAQS
ELAYLSKAVKLLTDDTPRDPYVTVPVARVRRTPTGGFELDEDFIPSCAHIDASPTLYRELRGLLDSLQAK
VDALYGLHRQSSQHIIEFRSGDIASFWLLHTACSSFGALSHLFHHPQLHPERLYQELLRMAGALLTFSNA
YQLNDLPRYNHAAPEACFQRLFQIVRDLLDTVISARYFKIALTEVKPSFHLGRIDSQRIDENAAFYLSVS
ADMPGPELVQTVPVRFKIGAPDDVEKCVLSALPGVKLTHAAQVPAAIPVRPGSYYFALEARGPLYERMLK
AQSMMLYVPSGIDDLKMELVAVTS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c1340070-1338736 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGTCGAAAGTATTTTGGGGCGAAGGGCTGTTTTTGCGGCCGCAGCATTTCCAGCGCCAGGACACCTACC
ACGAAGCAAGGCTGCAGGATCTGGCGCAGACGCTGCATCCCTATGGCTGGGGAACGCGCCGGATCCGTTT
CGATCCGCAGAGCATGGCCAGCGGCAGCTTGCGCGCGCTCGCCCTGTCGGTGGTCTTTCCCGATGGCGAA
TCGTACGACGCGCCGGCGCACGACGCGCTGCCCGATGCGCTGTCGCTGAATGACCTCCCCGCCGGCATCC
AGACCACCACGGTGTACCTGGCGCTGCCGTTGCTGCGCGACGACGGCGGCAACTGTAGCGATGCGGAGGG
TTCGCAACTGGCCCGCTACCAGCAGCTCAACCGGCCGACCAGCGACCTGTACACCGACGCGGCCCAATCG
GAACTGGCGTACCTGAGCAAGGCGGTGAAGCTGCTCACCGACGACACTCCGCGCGATCCGTACGTGACCG
TGCCGGTGGCGCGCGTGCGCCGTACCCCGACCGGCGGCTTCGAGCTGGACGAGGACTTCATCCCGTCATG
CGCGCACATCGACGCCTCGCCGACGCTGTATCGCGAACTGCGCGGCCTGCTCGACTCGCTGCAGGCCAAG
GTCGATGCGCTGTACGGGCTGCATCGACAATCGTCGCAGCACATCATCGAATTCCGCTCCGGCGACATCG
CCTCGTTCTGGCTGCTGCATACCGCCTGTTCCTCGTTCGGCGCGCTGTCGCACCTGTTCCATCATCCGCA
GCTGCACCCCGAGCGCCTGTACCAGGAACTGCTGCGCATGGCCGGCGCGTTGCTGACGTTCTCCAACGCC
TACCAGCTCAACGACCTGCCCCGGTACAACCACGCGGCGCCGGAAGCCTGCTTCCAGCGCCTGTTCCAGA
TCGTGCGCGACCTGCTCGACACGGTGATCTCGGCGCGCTACTTCAAGATCGCGCTGACCGAGGTCAAGCC
GTCGTTCCACCTGGGCCGGATCGATTCGCAGCGGATCGACGAGAACGCCGCGTTCTACCTGAGCGTGTCG
GCCGACATGCCCGGGCCGGAACTGGTGCAGACGGTGCCGGTGCGGTTCAAGATCGGTGCGCCGGACGACG
TCGAGAAGTGCGTGCTGTCGGCCCTGCCGGGCGTGAAACTGACCCACGCCGCGCAGGTGCCGGCAGCGAT
CCCGGTCCGTCCCGGCAGCTACTATTTCGCCCTGGAAGCGCGCGGGCCGCTGTACGAGCGCATGCTCAAG
GCGCAGTCTATGATGCTCTATGTGCCGTCAGGCATTGATGACCTCAAGATGGAACTTGTCGCGGTGACCT
CATGA