SecReT6
Protein ID: 384418343
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1351
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1340222..1340830 [-]
Productlipoprotein
NoteTssJ
UniProt IDG7TI16
KEGG IDxor:XOC_1351
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.80E-32, Aligned region: 18..174
Protein Sequence: 202 a.a.     [Download]
>gi|384418343|ref|YP_005627703.1| lipoprotein [Xanthomonas oryzae pv. oryzicola BLS256]
MNTSAHRFNFLLVLVVAALALSGCASGGIGKAMDKTLQAVGIKEAKPEASPIIPLRLLAGSNLNAGTDTH
ATAAVVKIYHLRSAQRFEQATFNAFLDQAGEQAALGADLLSVNEIVLTPSARQELNEQMSEGTTTLGVVA
LFRAPAEGRWRMAFDTRRKELPTQGITIGIHACALTTASPALVTRLAGDPSSLASVRCAAVR
 
Nucleotide Sequence: 609 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c1340830-1340222 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGAACACATCCGCCCACCGTTTCAATTTTCTGTTGGTCCTTGTTGTGGCCGCGCTAGCCCTGTCCGGCT
GCGCCAGCGGCGGCATCGGCAAGGCGATGGACAAGACCCTGCAGGCAGTGGGCATCAAGGAAGCAAAGCC
AGAGGCGTCTCCGATCATTCCCCTGCGGCTGCTTGCCGGCAGCAATCTGAATGCGGGCACCGATACGCAC
GCCACCGCAGCGGTGGTCAAGATCTATCACCTGCGCAGCGCGCAACGCTTCGAGCAGGCCACGTTCAACG
CGTTCCTCGATCAGGCCGGAGAGCAGGCGGCGCTGGGCGCGGACCTGCTGTCGGTCAACGAGATCGTTCT
GACGCCAAGCGCCCGCCAGGAACTGAACGAGCAGATGTCCGAAGGCACCACCACCCTGGGCGTGGTGGCC
TTGTTCCGCGCGCCGGCCGAGGGCCGCTGGCGCATGGCCTTCGATACGCGACGCAAGGAATTGCCGACCC
AGGGCATCACCATCGGCATTCACGCCTGCGCGCTGACCACCGCCAGCCCGGCGCTGGTCACCCGCCTGGC
GGGCGATCCCAGCAGCCTGGCGTCGGTGCGTTGCGCCGCTGTGCGCTAG