SecReT6
Protein ID: 384418345
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1353
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1341751..1342251 [+]
ProductEvpA protein
NoteTssB
UniProt IDG7TI18
KEGG IDxor:XOC_1353
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.30E-58, Aligned region: 11..164
Protein Sequence: 166 a.a.     [Download]
>gi|384418345|ref|YP_005627705.1| EvpA protein [Xanthomonas oryzae pv. oryzicola BLS256]
MAKKESIQKRLQKIRPPRVQLTYDVEKGDAIEQKELPFVVGVLGDFSGNPEQPLAKVKDRKFVNVDLDNF
DEVMEGMAPRAVYRVPNKISDAGGEFGVELKFKSIDDFRPEAVVDQVEPLRKLLESRTKLADLRNKLAGN
EKLEDLLTDVLNNTEQLKKLGREKEK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|384417079|ref|NC_017267.1|:1341751-1342251 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGGCTAAGAAGGAAAGCATCCAGAAACGTCTGCAGAAGATTCGGCCGCCGCGCGTGCAGCTGACCTACG
ACGTGGAAAAGGGTGACGCGATCGAACAGAAGGAGCTGCCGTTCGTGGTAGGCGTGCTTGGGGATTTCAG
CGGCAATCCCGAACAGCCCCTGGCCAAGGTCAAGGATCGCAAATTCGTCAACGTCGACCTCGACAACTTC
GACGAGGTGATGGAGGGAATGGCGCCGCGCGCGGTTTACCGCGTGCCGAACAAGATCAGCGATGCCGGCG
GCGAGTTCGGCGTCGAACTCAAGTTCAAGTCGATCGACGACTTCCGTCCGGAGGCTGTGGTCGATCAGGT
CGAACCGCTGCGCAAGCTGCTAGAATCGCGCACCAAGCTGGCAGACCTGCGCAACAAGCTGGCCGGCAAC
GAGAAGCTCGAAGACCTCCTAACGGACGTGTTGAACAACACCGAACAGCTGAAGAAGCTGGGTCGGGAAA
AGGAGAAGTAA