SecReT6
Protein ID: 384418346
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1354
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1342255..1343751 [+]
ProductEvpB protein
NoteTssC
UniProt IDG7TI19
KEGG IDxor:XOC_1354
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-194, Aligned region: 69..492
Protein Sequence: 498 a.a.     [Download]
>gi|384418346|ref|YP_005627706.1| EvpB protein [Xanthomonas oryzae pv. oryzicola BLS256]
MVAEVSSATHNSAPAALAETGLLDQIVEQSKVAKSETEHQRAKDIISELAKEVLEGTVVVSDNLNLTLDA
RIAEIDRIISEQLSAVMHAPEFQKLESSWRGLHYMCEQTSTGVTMKIKVFNSPQRDLVRDFKSAIDFDQS
ALFKKVYEEEFGTFGGAPFGALVGDYYIGRQPEDMYFVEQMSHVAAAAHAPFISAASESMFGLETFTDLG
KPRDLAKVFDTVEYAKWKSFRESEDSRYVGLTMPRFLGRLPYNPKDGTTVEGFNFVEDVDAADHSKYLWC
NTAYAMATRLTKAFEDYGWCAAIRGVEGGGLVEDLPTHTFRTDDGEVALKCPTEIAITDRREKELSDLGF
IPLVHCKNTDYAAFFGAQSAQKPKKYNTNAANANAILSAQLQYMFAVSRIAHYLKAMMREKIGSFASARN
VEDFLNRWISQYVLLDDNAGQEAKAQYPLREASVQVSEVPGKPGVYRAVAFIRPHFQLDELSVSLRLVAE
LPAGTKKA
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|384417079|ref|NC_017267.1|:1342255-1343751 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGGTCGCAGAGGTTTCGAGTGCCACCCACAATTCGGCGCCCGCCGCGCTGGCAGAAACAGGCTTGCTCG
ACCAGATCGTCGAGCAGAGCAAGGTCGCCAAATCGGAGACCGAGCACCAGCGTGCGAAGGACATCATCTC
CGAGCTGGCCAAGGAGGTGCTGGAAGGTACCGTCGTGGTGTCGGACAACCTCAATCTGACGCTGGACGCG
CGCATTGCCGAGATCGACCGGATCATCTCCGAGCAGCTGAGCGCGGTGATGCATGCGCCGGAGTTCCAGA
AGCTGGAGAGCAGCTGGCGCGGCCTGCACTACATGTGCGAGCAGACGTCCACCGGCGTGACGATGAAGAT
CAAGGTCTTCAACTCGCCCCAGCGGGATCTGGTGCGCGACTTCAAGTCGGCGATCGACTTCGATCAAAGC
GCGCTGTTCAAGAAGGTCTACGAGGAAGAGTTTGGCACCTTCGGCGGTGCGCCATTCGGCGCATTGGTCG
GCGACTACTACATCGGCCGCCAGCCGGAGGACATGTACTTCGTCGAGCAGATGTCGCATGTGGCCGCCGC
GGCGCACGCGCCCTTCATCTCTGCCGCGTCTGAATCGATGTTCGGTCTGGAAACCTTCACCGACCTGGGT
AAACCGCGCGATTTGGCCAAGGTGTTCGACACTGTCGAATACGCCAAGTGGAAGTCGTTCCGTGAGTCGG
AGGATAGCCGCTACGTCGGCCTGACCATGCCGCGTTTTCTCGGGCGGCTGCCGTACAACCCGAAGGACGG
CACTACGGTCGAAGGCTTCAACTTCGTCGAAGACGTCGACGCTGCCGACCATAGCAAGTATCTGTGGTGC
AACACCGCTTATGCGATGGCCACGCGCCTGACCAAGGCGTTCGAGGACTACGGTTGGTGCGCGGCGATCC
GCGGTGTGGAAGGCGGTGGCCTGGTCGAAGACCTGCCGACCCACACCTTCCGCACCGACGACGGCGAAGT
GGCGCTGAAGTGCCCGACCGAGATCGCGATCACCGACCGCCGCGAGAAGGAACTCAGCGACCTGGGCTTC
ATCCCGCTGGTACATTGCAAGAACACCGACTACGCGGCGTTCTTCGGTGCGCAGTCGGCGCAGAAGCCGA
AGAAGTACAACACCAATGCGGCCAATGCCAACGCGATCCTGTCGGCGCAGCTGCAGTACATGTTCGCCGT
GTCGCGTATCGCCCATTACCTCAAGGCGATGATGCGCGAGAAGATTGGCAGTTTCGCCTCGGCGCGTAAT
GTCGAGGATTTCCTGAACCGTTGGATCTCCCAGTACGTGTTGTTGGACGACAACGCCGGTCAGGAAGCAA
AGGCGCAATACCCCTTGCGGGAAGCGTCCGTACAAGTTTCGGAAGTGCCGGGGAAACCCGGTGTCTACCG
CGCGGTGGCCTTCATCAGGCCGCATTTCCAGCTCGATGAGCTGTCTGTTTCGTTGCGTCTGGTGGCCGAA
CTGCCGGCTGGTACCAAGAAGGCGTAG