SecReT6
Protein ID: 384418347
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1355
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1343893..1344390 [+]
Producthypothetical protein
NoteTssD
UniProt IDG7TI20
KEGG IDxor:XOC_1355
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-40, Aligned region: 5..138
Protein Sequence: 165 a.a.     [Download]
>gi|384418347|ref|YP_005627707.1| hypothetical protein XOC_1355 [Xanthomonas oryzae pv. oryzicola BLS256]
MQHAFLSIDTIKGESHDDKHTDWVEIKSFSQDLLQPRSATASTAGGQSAARVNLSPIEIVKSIDLSTTAL
NQACANGTTFPKARIEFMRADKDGNAINYYLVELMNVLVHRVTTTVDEDGMPQEVVQLSFGAIKWTYNQQ
KPEGGVGGKAVAQWSATKNIPNYTV
 
Nucleotide Sequence: 498 bp     [Download]
>gi|384417079|ref|NC_017267.1|:1343893-1344390 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGCAGCACGCGTTTCTTTCTATCGATACCATCAAGGGTGAATCGCACGACGACAAGCACACGGACTGGG
TGGAGATCAAGTCGTTCTCCCAGGACTTGTTGCAGCCGCGCTCGGCCACCGCATCCACCGCTGGCGGTCA
GTCGGCCGCTCGTGTAAACCTGTCGCCGATCGAGATCGTCAAGTCGATCGATCTGTCCACCACCGCGCTG
AATCAGGCGTGCGCCAACGGCACCACCTTCCCCAAAGCCCGCATCGAGTTCATGCGCGCCGACAAGGACG
GCAATGCCATCAACTACTACTTGGTTGAGTTGATGAACGTGCTGGTACACCGCGTCACCACGACGGTGGA
CGAGGACGGCATGCCGCAAGAAGTCGTCCAGCTGAGCTTCGGCGCGATCAAGTGGACCTACAACCAGCAG
AAGCCGGAAGGCGGAGTCGGCGGCAAGGCGGTTGCGCAGTGGAGTGCTACCAAGAACATTCCTAACTACA
CCGTTTGA