SecReT6
Protein ID: 384418349
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1357
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1344538..1345026 [+]
Producthypothetical protein
NoteTssE
UniProt IDG7TI22
KEGG IDxor:XOC_1357
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.90E-22, Aligned region: 31..138
Protein Sequence: 162 a.a.     [Download]
>gi|384418349|ref|YP_005627709.1| hypothetical protein XOC_1357 [Xanthomonas oryzae pv. oryzicola BLS256]
MKGLEPSLLEKLFDDTPKSTGSSHVFKAISIDQYKESVARDLEGLLNTRSAFSEEGLTEFPNCKQSLLTY
GLGDFSAMSLANGYDRTMICRSLEQAIARHERRLRNVHVTLETAGQFGGGLHFTIHALLDMEPAREPVSF
DAMLQPSTLQYSVSRLRRQAAP
 
Nucleotide Sequence: 489 bp     [Download]
>gi|384417079|ref|NC_017267.1|:1344538-1345026 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGAAGGGACTCGAACCCAGTCTGTTGGAAAAATTGTTCGACGACACGCCCAAGTCCACGGGTAGCTCGC
ATGTGTTCAAGGCCATCTCCATCGACCAATACAAGGAATCGGTCGCTCGCGACCTGGAAGGCCTATTGAA
CACCCGTTCGGCCTTCAGCGAAGAAGGCCTCACCGAATTTCCCAATTGCAAGCAGTCGTTGCTGACCTAC
GGCCTCGGCGATTTTTCCGCGATGAGCCTGGCCAATGGCTACGACCGCACGATGATCTGCCGCTCGCTGG
AGCAGGCGATCGCGCGCCATGAGCGGCGCCTGCGCAACGTGCACGTGACGCTGGAGACCGCCGGCCAGTT
CGGCGGCGGCCTGCATTTCACCATCCATGCGTTGCTGGACATGGAGCCGGCGCGCGAGCCGGTGAGCTTC
GACGCCATGCTGCAACCGTCCACCCTGCAGTACTCGGTCAGCCGCCTGCGGCGCCAGGCAGCGCCCTGA