SecReT6
Protein ID: 384418350
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1358
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1345029..1346864 [+]
ProductEvpF protein
NoteTssF
UniProt IDG7TI23
KEGG IDxor:XOC_1358
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.70E-206, Aligned region: 4..610
Protein Sequence: 611 a.a.     [Download]
>gi|384418350|ref|YP_005627710.1| EvpF protein [Xanthomonas oryzae pv. oryzicola BLS256]
MQDLLPYYERELGYLRRYGREFAERYPKIAGRLQLSADGSQDPHVERLIEAFALMGARISKRIEDDYPEF
TDALLEVLYPHYLRPFPSCSIAYFDMEGVAAKLSAPIRVPRGSYLQSRPVRGINCRFRTAYDVVLVPVAV
KAASYRGVAEAPMAVSLPPGTGAQISISFELLSDQASFAGLGTDALRFFVDGEPSFCSAMRDALALGVKA
AYVESDGSGRWRRLADTPLVPVGFADDESLIDFPARSHPAYRLLTELFGYPDKFGFFDLQLKPVTAGASR
WFTLHLVLHATPPDRAANQVLEELDCKNIRLGCTPVVNLFAQHGEPIRVTHRSVTYPVIADGRRAFAYEV
HSIDSVHRIRQTPQGELIQEFRPFYSLHHGEDPERAGQYWVARRDEDVARESPGYETEVSFVDLEFNPTL
PQTDVVSVELTCSNRDLPSQLAYGIAGGDLSIEGGTPARAISLLRKPSRPLRFRHGRGAQWRLISHLSLN
QLSLTGSGLPALKEMLRLYDISGSSVSSRQIDGIVGIEQYPVTTWLSGKHFASVVRGLEVRLTISENHFV
GTGVAAFAHVLDHFFGLYVHANSFIRLVLISSDTGEELVRCLPRSGESILA
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|384417079|ref|NC_017267.1|:1345029-1346864 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGCAAGACCTGCTTCCCTACTACGAACGCGAACTGGGCTATCTGCGTCGCTACGGGCGCGAGTTCGCCG
AGCGCTATCCCAAGATTGCCGGGCGCCTGCAGCTGTCGGCCGACGGCAGCCAGGATCCGCATGTCGAGCG
CCTGATCGAGGCGTTCGCGCTGATGGGCGCGCGCATCTCCAAGCGCATTGAGGACGACTACCCCGAGTTC
ACCGACGCGCTGCTGGAAGTGCTGTATCCGCACTATCTGCGGCCGTTTCCGTCCTGCTCCATCGCCTATT
TCGACATGGAAGGCGTGGCTGCCAAGCTCAGCGCGCCGATCCGCGTGCCGCGCGGTAGCTACCTGCAGTC
GCGCCCGGTGCGCGGGATCAACTGCCGGTTCCGCACCGCCTACGACGTGGTACTGGTGCCGGTGGCGGTG
AAGGCCGCCAGCTACCGTGGCGTGGCCGAAGCGCCGATGGCGGTCAGCCTGCCGCCGGGCACCGGCGCAC
AGATCTCGATCAGCTTCGAGCTGTTGTCCGACCAGGCCTCGTTCGCTGGCCTGGGCACCGACGCGCTGCG
TTTCTTCGTCGACGGCGAGCCGTCGTTCTGCTCGGCGATGCGCGATGCGCTGGCGCTGGGGGTCAAGGCA
GCCTATGTCGAGTCCGACGGCAGCGGACGCTGGCGCCGGCTGGCGGACACCCCGCTGGTGCCAGTGGGAT
TCGCCGACGACGAATCGCTGATCGATTTCCCGGCGCGTTCGCACCCGGCCTACCGCCTGCTGACCGAGCT
GTTCGGCTACCCGGACAAGTTCGGCTTCTTCGATCTTCAGCTCAAGCCGGTGACCGCCGGCGCCAGCCGC
TGGTTCACGTTGCACCTGGTCCTACACGCGACGCCGCCCGATCGCGCCGCCAACCAAGTGCTCGAGGAGT
TGGATTGCAAGAACATCCGCCTGGGCTGCACCCCGGTGGTGAACCTGTTCGCGCAGCACGGCGAGCCGAT
CCGCGTCACCCATCGCAGCGTCACCTATCCGGTGATCGCCGACGGGCGCCGCGCCTTTGCCTACGAAGTG
CATTCGATCGATTCGGTGCACCGTATCCGGCAGACTCCGCAGGGCGAGCTGATCCAGGAGTTCCGCCCGT
TCTATTCGCTGCACCATGGCGAAGACCCCGAGCGCGCCGGCCAGTATTGGGTGGCGCGGCGCGACGAGGA
TGTGGCGCGGGAGAGTCCCGGTTACGAAACCGAAGTGAGCTTCGTGGACCTGGAATTCAATCCGACCCTG
CCGCAGACCGATGTGGTCAGCGTCGAACTCACCTGCAGCAATCGCGATTTGCCCAGCCAGCTCGCCTACG
GCATCGCCGGCGGCGACCTGTCGATCGAGGGCGGAACGCCGGCGCGCGCGATCAGCCTGTTGCGCAAGCC
GAGCCGGCCACTGCGGTTCCGCCACGGACGCGGCGCGCAATGGCGGCTGATCTCGCACCTGTCGTTGAAT
CAGCTGTCGCTGACCGGCAGCGGCTTGCCGGCGTTGAAGGAGATGCTGCGGCTGTACGACATCTCCGGCA
GCAGCGTGTCGTCGCGGCAGATCGACGGCATCGTCGGCATCGAGCAGTATCCGGTCACCACCTGGCTGTC
CGGCAAGCATTTCGCATCGGTGGTGCGCGGCCTGGAAGTGCGTTTGACCATCAGCGAAAACCATTTCGTC
GGGACCGGCGTGGCCGCGTTCGCGCATGTGCTCGACCACTTCTTCGGCCTCTACGTCCACGCCAACAGCT
TTATCCGGCTGGTGCTCATTTCCAGCGACACAGGGGAGGAACTCGTCCGATGCTTACCGCGAAGCGGCGA
ATCGATCCTGGCGTAG