SecReT6
Protein ID: 384418351
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1359
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1346828..1347919 [+]
Producthypothetical protein
NoteTssG
UniProt IDG7TI24
KEGG IDxor:XOC_1359
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-92, Aligned region: 18..344
Protein Sequence: 363 a.a.     [Download]
>gi|384418351|ref|YP_005627711.1| hypothetical protein XOC_1359 [Xanthomonas oryzae pv. oryzicola BLS256]
MLTAKRRIDPGVALQLLAEPHRFQFFQAMRILERVFQRQGVKAGQALPTRVRFHNSLSLAFPATELDPVG
QAYSQDGERLESDAALAFAIETESLGEVHLTPNFMGLLGTSGALPLHYTETLHERELYQRDRTPRAFLDM
FSNRAVALHYAAWKKHRLALQYELDRRERFLPLVLSLLGMGMPGLRDRMVDGGGDVFDQAVAYYAGAIRQ
RPISAKLLQRVLADYFKVPVELEQFVGAWYKVPAQQATRLGQANATLGSSALAGDRVWQRDLRMRLRFGP
LQREAFDQFLPGGSAAKALSKWLMLLTGGGLEYEVKLVLRAEDVRGSGVGEALGVRLGWDSYLCSRPQTQ
PRADTTYGLHTLQ
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|384417079|ref|NC_017267.1|:1346828-1347919 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGCTTACCGCGAAGCGGCGAATCGATCCTGGCGTAGCGCTGCAACTGCTGGCCGAGCCGCATCGCTTCC
AGTTTTTCCAGGCGATGCGGATTCTGGAGCGGGTGTTCCAGCGCCAGGGGGTCAAGGCCGGTCAGGCCCT
GCCCACACGCGTACGTTTTCACAACTCGCTGTCGTTGGCGTTTCCGGCGACCGAGCTGGACCCCGTCGGT
CAGGCCTATTCGCAGGACGGCGAGCGCCTGGAAAGCGATGCGGCGCTGGCGTTCGCGATCGAGACCGAGA
GCCTGGGCGAAGTGCATCTGACCCCGAACTTCATGGGGTTGCTGGGCACCTCCGGCGCATTGCCGCTGCA
CTACACCGAGACCCTGCACGAACGCGAGCTGTACCAGCGCGACCGTACCCCACGCGCGTTCCTGGACATG
TTCTCCAACCGCGCGGTGGCGCTGCACTACGCCGCGTGGAAGAAGCACCGGCTGGCGCTGCAGTATGAGC
TGGACCGGCGCGAGCGCTTCCTGCCGCTGGTGCTGTCGCTGCTGGGCATGGGCATGCCGGGACTACGCGA
TCGCATGGTCGACGGCGGCGGCGACGTCTTCGACCAGGCGGTGGCGTACTACGCCGGCGCCATCCGCCAG
CGGCCGATCTCGGCCAAGCTGCTGCAGCGCGTGCTGGCCGACTACTTCAAGGTGCCGGTGGAGCTGGAGC
AGTTCGTCGGCGCCTGGTACAAGGTGCCGGCGCAACAGGCCACGCGGCTGGGCCAGGCCAACGCCACTCT
CGGGTCCAGTGCGCTGGCCGGCGACCGGGTGTGGCAGCGCGACCTGCGCATGCGCCTGCGCTTCGGTCCG
CTGCAGCGTGAGGCTTTCGACCAGTTCCTGCCCGGAGGCAGCGCCGCGAAGGCCTTGTCGAAATGGCTGA
TGCTGCTCACCGGCGGCGGGCTGGAATACGAGGTCAAGCTGGTGCTGCGCGCCGAGGACGTACGCGGCTC
CGGCGTCGGCGAAGCACTGGGCGTACGCCTGGGCTGGGACAGCTACCTATGCTCGCGCCCGCAGACCCAG
CCGCGCGCCGACACCACCTACGGTCTGCATACCCTTCAATAG