SecReT6
Protein ID: 384418352
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1360
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1348005..1350737 [+]
Productprotease associated ATPase ClpB
NoteTssH
UniProt IDG7TI25
KEGG IDxor:XOC_1360
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.30E-44, Aligned region: 238..295
AAA_2 [PF07724], Evalue: 2.30E-44, Aligned region: 640..808
AAA [PF00004], Evalue: 4.20E-20, Aligned region: 239..352
AAA [PF00004], Evalue: 4.20E-20, Aligned region: 645..768
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 239..261
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 313..369
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 644..764
Clp_N [PF02861], Evalue: 2.70E-12, Aligned region: 23..74
Clp_N [PF02861], Evalue: 2.70E-12, Aligned region: 113..125
Clp_N [PF02861], Evalue: 2.70E-12, Aligned region: 405..418
ClpB_D2-small [PF10431], Evalue: 1.10E-11, Aligned region: 815..891
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 216..268
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 283..317
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 636..683
AAA_16 [PF13191], Evalue: 4.00E-11, Aligned region: 804..850
AAA_22 [PF13401], Evalue: 9.20E-08, Aligned region: 238..325
AAA_22 [PF13401], Evalue: 9.20E-08, Aligned region: 641..665
AAA_22 [PF13401], Evalue: 9.20E-08, Aligned region: 706..738
AAA_17 [PF13207], Evalue: 3.40E-07, Aligned region: 79..108
AAA_17 [PF13207], Evalue: 3.40E-07, Aligned region: 239..304
AAA_17 [PF13207], Evalue: 3.40E-07, Aligned region: 644..680
Sigma54_activat [PF00158], Evalue: 8.90E-07, Aligned region: 221..266
Sigma54_activat [PF00158], Evalue: 8.90E-07, Aligned region: 627..762
AAA_29 [PF13555], Evalue: 6.20E-05, Aligned region: 231..254
AAA_29 [PF13555], Evalue: 6.20E-05, Aligned region: 640..669
AAA_29 [PF13555], Evalue: 6.20E-05, Aligned region: 747..771
IstB_IS21 [PF01695], Evalue: 8.00E-05, Aligned region: 232..263
IstB_IS21 [PF01695], Evalue: 8.00E-05, Aligned region: 644..662
AAA_25 [PF13481], Evalue: 0.00012, Aligned region: 237..262
AAA_25 [PF13481], Evalue: 0.00012, Aligned region: 294..332
AAA_25 [PF13481], Evalue: 0.00012, Aligned region: 364..411
AAA_25 [PF13481], Evalue: 0.00012, Aligned region: 640..662
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 218..264
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 291..375
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 641..682
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 715..738
AAA_18 [PF13238], Evalue: 0.00016, Aligned region: 239..270
AAA_18 [PF13238], Evalue: 0.00016, Aligned region: 646..669
AAA_14 [PF13173], Evalue: 0.00019, Aligned region: 239..373
AAA_14 [PF13173], Evalue: 0.00019, Aligned region: 642..725
AAA_19 [PF13245], Evalue: 0.00032, Aligned region: 239..264
AAA_19 [PF13245], Evalue: 0.00032, Aligned region: 447..470
AAA_19 [PF13245], Evalue: 0.00032, Aligned region: 524..524
AAA_19 [PF13245], Evalue: 0.00032, Aligned region: 640..666
MobB [PF03205], Evalue: 0.00056, Aligned region: 240..265
MobB [PF03205], Evalue: 0.00056, Aligned region: 643..676
NACHT [PF05729], Evalue: 0.00056, Aligned region: 239..266
NACHT [PF05729], Evalue: 0.00056, Aligned region: 645..665
Zeta_toxin [PF06414], Evalue: 0.001, Aligned region: 134..154
Zeta_toxin [PF06414], Evalue: 0.001, Aligned region: 239..260
Zeta_toxin [PF06414], Evalue: 0.001, Aligned region: 635..684
RNA_helicase [PF00910], Evalue: 0.001, Aligned region: 240..262
RNA_helicase [PF00910], Evalue: 0.001, Aligned region: 645..666
SRP54 [PF00448], Evalue: 0.0014, Aligned region: 239..263
SRP54 [PF00448], Evalue: 0.0014, Aligned region: 643..674
T2SE [PF00437], Evalue: 0.0028, Aligned region: 227..262
T2SE [PF00437], Evalue: 0.0028, Aligned region: 630..681
DUF258 [PF03193], Evalue: 0.0035, Aligned region: 217..258
DUF258 [PF03193], Evalue: 0.0035, Aligned region: 629..656
DUF815 [PF05673], Evalue: 0.004, Aligned region: 230..314
DUF815 [PF05673], Evalue: 0.004, Aligned region: 475..504
DUF815 [PF05673], Evalue: 0.004, Aligned region: 599..681
DUF2075 [PF09848], Evalue: 0.0089, Aligned region: 239..341
Protein Sequence: 910 a.a.     [Download]
>gi|384418352|ref|YP_005627712.1| protease associated ATPase ClpB [Xanthomonas oryzae pv. oryzicola BLS256]
MSINLKTLISKLDDTCRQAAERAANLCMARGNYEVDLEHLFLALLEQPQSDFVLIARRCGISPETLERDL
SEEVGRFKAGNTRTPVFSQHLPTLFEHAWLIASLDSETTRIRSGHLLLALLTEPDLSQLAYRGSKQFVKI
KLDALKHDFARLTEGSQEAGQSLRFADAGQADVGGDPVDGLAGVPDGKGGLTKTPALDQFTTNLVQRARD
AQIDPVIGRDGEIRQVIDILMRRRQNNPILTGEAGVGKTAVVEGLARRIAEKDVPDVLQGVELHVLDMGL
LQAGASVKGEFENRLKNVIDEVKKSPHPIILFIDEAHTMIGAGGTAGQNDAANLLKPALARGELRTIAAT
TWSEYKKYFEKDAALARRFQVVKVEEPSETLAAAMLRGMVPLMEKHFGIRVMDEAVTEAVRLSHRYISGR
QLPDKAVSVLDTACAKVALGQSATPAIIEDTRKHLDRLAAELAALNRETSGGARHHDARVAELLQAQESA
RKVLADNQTRLVRERELAERIVALRAQLEAVPAAAEPAAAAAKPARGAAKQATAAASPQHAQLDALLAEL
GELQGETPMVPLQVDGGVVAEIVSAWTGVPLGRMVKDEIRTVRNLDSLLGERVIGQDHALAAISQRVRTA
TAKLEDPNKPRGVFLFVGPSGVGKTETALALADILYGGERKLITINMSEYQEAHSVSGLKGSPPGYVGYG
EGGVLTEAVRRNPYSVVLLDEVEKAHPDVLEMFFQVFDKGVMDDAEGREIDFRNTLIILTSNVGSSQIMQ
ACLNKPAEEIPAADALAEALRPILMRSFKPAFLGRLKVVPYYPISDDVLAQIIALKLGRIRERVATNHKA
AFQWDQSLVEAVLARCTEVDSGARNVDHILNGTLLPEIAESVLAAMAEGGNINAIKVGAGKNGAFKYKLS
 
Nucleotide Sequence: 2733 bp     [Download]
>gi|384417079|ref|NC_017267.1|:1348005-1350737 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGAGCATCAATCTCAAGACCCTGATCAGCAAACTCGACGACACCTGCCGGCAGGCGGCCGAGCGCGCGG
CCAATCTGTGCATGGCGCGCGGCAACTACGAAGTCGACCTGGAGCATCTGTTCCTGGCGCTGCTGGAACA
ACCGCAAAGCGATTTCGTGCTGATCGCGCGCCGCTGCGGCATTTCGCCGGAGACGCTGGAACGCGATCTC
AGCGAGGAGGTCGGCCGCTTCAAGGCCGGCAATACGCGCACGCCGGTATTTTCCCAGCACCTGCCCACGC
TGTTCGAGCACGCCTGGCTGATCGCCTCGCTGGATTCGGAAACCACGCGCATCCGCAGCGGTCATCTGCT
GCTGGCGCTGCTGACCGAGCCAGACCTGTCGCAGCTGGCCTACCGCGGTTCCAAGCAGTTCGTGAAGATC
AAGCTCGACGCGCTCAAGCACGACTTCGCCCGCCTCACCGAAGGCTCGCAGGAAGCCGGGCAAAGCCTGC
GTTTCGCCGATGCCGGCCAGGCCGACGTCGGCGGCGACCCGGTCGATGGCCTCGCCGGCGTGCCGGACGG
CAAGGGCGGCCTGACCAAGACCCCGGCGCTGGACCAGTTCACCACCAACCTCGTCCAGCGCGCCCGCGAT
GCGCAGATCGACCCGGTGATCGGCCGCGACGGCGAGATCCGCCAGGTGATCGACATCCTGATGCGGCGGC
GCCAGAACAATCCGATCCTCACCGGCGAAGCCGGCGTCGGCAAGACCGCGGTCGTCGAGGGGCTGGCCCG
GCGCATCGCCGAGAAGGACGTGCCGGACGTGTTGCAGGGGGTGGAACTGCATGTGCTGGACATGGGCTTG
CTGCAGGCCGGCGCCAGCGTCAAGGGCGAGTTCGAGAACCGGCTGAAGAACGTCATCGACGAGGTCAAGA
AGAGCCCGCATCCGATCATCCTGTTCATCGACGAGGCGCACACGATGATCGGTGCCGGCGGGACCGCCGG
CCAGAACGACGCGGCGAACCTGCTCAAGCCGGCGCTGGCGCGCGGCGAGCTGCGCACCATCGCGGCCACC
ACCTGGAGCGAATACAAGAAGTACTTCGAGAAGGACGCGGCGCTGGCACGGCGCTTCCAGGTGGTCAAGG
TCGAGGAGCCGAGCGAGACGCTGGCTGCGGCGATGCTGCGCGGCATGGTGCCGCTGATGGAGAAGCACTT
CGGCATCCGGGTGATGGACGAGGCGGTCACCGAGGCGGTGCGCCTGTCGCACCGCTACATCAGCGGCCGC
CAGCTGCCGGACAAGGCGGTCAGCGTGCTCGATACCGCCTGCGCCAAGGTCGCGCTCGGGCAGAGCGCCA
CCCCGGCGATCATCGAAGACACGCGCAAGCATCTGGACCGGCTGGCCGCGGAGTTGGCCGCGTTGAACCG
CGAGACGTCCGGCGGCGCCCGCCACCACGACGCGCGCGTGGCCGAGCTACTGCAAGCGCAGGAAAGCGCA
CGCAAGGTGCTGGCCGACAACCAGACGCGGCTGGTGCGCGAGCGCGAACTGGCCGAGCGCATCGTCGCCC
TGCGCGCGCAGCTGGAAGCGGTGCCGGCGGCCGCCGAACCCGCGGCCGCCGCCGCCAAGCCGGCACGCGG
CGCGGCGAAGCAGGCCACCGCGGCGGCTTCGCCGCAGCACGCGCAGCTGGACGCGCTGCTCGCCGAGCTG
GGCGAGCTGCAGGGCGAAACCCCGATGGTGCCGCTGCAGGTCGACGGCGGCGTGGTCGCCGAGATCGTCT
CGGCCTGGACCGGGGTGCCGCTGGGGCGCATGGTCAAGGACGAGATCCGCACCGTGCGCAACCTCGACAG
CCTGCTGGGCGAGCGCGTCATCGGCCAGGACCATGCGCTGGCCGCGATCTCCCAGCGCGTGCGCACCGCT
ACCGCCAAGCTGGAAGACCCGAACAAGCCCCGCGGCGTCTTCCTCTTCGTCGGCCCGTCCGGCGTCGGCA
AGACCGAGACCGCGCTGGCGCTGGCCGACATCCTGTACGGCGGCGAGCGCAAGCTGATCACCATCAACAT
GAGCGAGTACCAGGAAGCGCACAGCGTGTCCGGGCTGAAGGGCTCTCCGCCTGGCTACGTCGGCTACGGC
GAGGGCGGCGTGCTGACCGAGGCGGTGCGGCGCAACCCGTACAGTGTGGTGCTGCTGGACGAGGTGGAGA
AAGCACACCCGGACGTGCTGGAGATGTTCTTCCAAGTGTTCGACAAGGGCGTGATGGACGATGCCGAAGG
CCGCGAGATCGACTTCCGCAACACCTTGATCATCCTCACGTCCAATGTCGGTTCCTCGCAGATCATGCAG
GCCTGCCTGAACAAGCCGGCCGAGGAGATTCCGGCCGCCGACGCATTGGCCGAGGCGTTGCGCCCGATCC
TGATGCGCAGCTTCAAGCCGGCCTTCCTCGGCCGGCTGAAGGTGGTGCCGTATTACCCGATCAGTGACGA
CGTGCTGGCGCAGATCATCGCGCTCAAGCTCGGCCGCATCCGCGAACGCGTGGCCACCAACCACAAGGCC
GCCTTCCAATGGGACCAGAGCCTGGTGGAGGCGGTGTTGGCGCGCTGTACGGAAGTGGATTCGGGTGCGC
GCAACGTCGACCACATTCTGAATGGCACGCTGTTGCCGGAAATCGCCGAGAGCGTGCTCGCGGCGATGGC
CGAAGGCGGCAACATCAACGCCATCAAGGTAGGCGCCGGCAAGAACGGCGCGTTCAAATACAAGTTATCC
TGA