SecReT6
Protein ID: 384418354
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1362
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1351214..1353973 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDG7TI27
KEGG IDxor:XOC_1362
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.30E-71, Aligned region: 40..354
Phage_GPD [PF05954], Evalue: 2.30E-71, Aligned region: 808..838
DUF2345 [PF10106], Evalue: 8.50E-38, Aligned region: 722..885
T6SS_Vgr [PF13296], Evalue: 5.30E-27, Aligned region: 292..322
T6SS_Vgr [PF13296], Evalue: 5.30E-27, Aligned region: 578..682
Phage_base_V [PF04717], Evalue: 2.10E-19, Aligned region: 224..249
Phage_base_V [PF04717], Evalue: 2.10E-19, Aligned region: 433..536
Protein Sequence: 919 a.a.     [Download]
>gi|384418354|ref|YP_005627714.1| Rhs element Vgr protein [Xanthomonas oryzae pv. oryzicola BLS256]
MDPVATVLSALAAPHQQERLLRLHTPLGPDVLVAETLDGRESVDGGGFRFDVGALSANAGLPLDDLLGQP
VLLELLTAESRTALRPFHGHVTAFERLGSNGGLARYRLVVEPWLALLAQRVDSYVFQDMSVVEIAESVFA
DYAGQGALAPAWRWELSDRSTYARRSLTTQYEETDFAFLSRLLAEEGIAYWFEHTGAADSDTRGTHTLVL
SDHNAAFADLGTVRYHRTDVTEQQDSVQQWVQAHRWRATSLSRASWDYRSRSLRLAGAEGTPLGDIGAED
VDTAGPYGWQDSTRGQRRAQQHLDAQQVTAQTIQGQGTWRQLAPGTRFGLRQHAGVAADAAFLCLQVRHQ
ARNNLGAEVFDALEQALGAVAVAGAPLPPALAGLSGGYVPAQDEAAVEFYRNQFTAIPATATYRPQTEDG
HGVRLHPKPTVVGTLSAIVVSDGDPVQSDRDHRIKVQFPFQRGADASSALAHPGGEDNAPGSASAWTWVR
VMTPWAGDNWGGVVLPRKGQEVLVGFLEGDIDRPVVIGSVYNGRGQDDAAHNQVGGGGAGATGNAPAWFQ
GNAHGAVFTGFKSQALAQSQDGTGGYQQLRLDDTPGQGRAQLSTTQHASSLTLGHLKGGHDNLREGERGY
GADLSTQAYGAVRAGQGLLLSSEPGNTQLAATGALSQLQQGSDLLKRLNDAARTQQAGLPSEPESLPTQD
GLKTLQDHLQATHSGSAAGAIGGGAGEVPGWSAPVLLGSGQAGVMSLTPADQVWVSGTQTALLAGSALNW
LSQGHLVLAVAGGLVLYTQGSDPVAGSPNQERGIALHAAQGTLSARAHRSTATLAAKTQVRIVSTTADVQ
LAAPTKHLLATAAGAYIKLDGDDIELGAPGVVAFKGGQQVLTGPQGASVSTDIPKGNFKGCEPNVMNALA
RYDATAKIE
 
Nucleotide Sequence: 2760 bp     [Download]
>gi|384417079|ref|NC_017267.1|:1351214-1353973 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGGACCCGGTCGCTACCGTTCTTTCCGCATTGGCCGCCCCGCACCAGCAAGAACGCCTGCTGCGGTTGC
ACACCCCGCTGGGCCCCGACGTGCTGGTTGCCGAGACCCTGGATGGCCGCGAGTCGGTCGATGGCGGCGG
CTTCCGTTTCGACGTGGGCGCACTATCGGCCAACGCCGGCTTGCCGCTGGACGACCTGCTCGGCCAGCCG
GTGCTGCTGGAACTGCTCACCGCCGAGTCGCGCACCGCGCTGCGCCCGTTCCACGGCCATGTCACCGCGT
TCGAGCGGCTCGGCAGCAACGGCGGCCTGGCGCGCTACCGGCTGGTGGTGGAGCCGTGGCTGGCGCTGCT
GGCCCAGCGCGTGGACAGCTACGTGTTCCAGGACATGAGCGTGGTGGAGATCGCCGAGAGCGTGTTCGCC
GACTACGCCGGGCAAGGCGCGCTGGCGCCGGCGTGGCGCTGGGAGCTGTCCGACCGCAGCACGTACGCCA
GGCGCAGCCTGACCACGCAATACGAAGAGACCGACTTCGCGTTCCTGAGCCGGCTGCTGGCCGAGGAAGG
CATCGCCTATTGGTTCGAGCACACTGGCGCAGCCGACAGCGATACGCGCGGCACGCACACGCTGGTGCTG
TCGGACCATAACGCCGCCTTCGCCGACCTGGGCACGGTGCGCTACCACCGCACCGACGTCACCGAGCAGC
AGGACAGCGTGCAGCAGTGGGTACAGGCACATCGCTGGCGCGCGACCAGTCTGTCGCGGGCCAGCTGGGA
CTACCGCAGCCGCAGCCTGCGCCTGGCCGGCGCCGAAGGCACGCCGCTGGGCGACATCGGTGCCGAGGAC
GTGGACACCGCCGGCCCGTACGGCTGGCAGGACAGCACCCGTGGCCAGCGCCGCGCGCAGCAGCATCTGG
ATGCGCAGCAGGTGACGGCGCAGACCATCCAGGGCCAGGGGACCTGGCGGCAACTGGCACCGGGCACGCG
TTTCGGGCTGCGCCAGCATGCGGGCGTGGCGGCCGATGCGGCGTTCCTGTGCCTGCAGGTGCGGCACCAG
GCCCGCAACAACCTGGGCGCGGAGGTGTTCGACGCGCTGGAGCAGGCGCTGGGCGCGGTGGCGGTGGCCG
GCGCGCCGCTGCCGCCGGCGCTGGCAGGCCTGAGCGGCGGATATGTGCCGGCGCAGGATGAGGCGGCGGT
AGAGTTCTACCGCAACCAGTTCACCGCCATACCGGCCACCGCGACCTACCGGCCGCAAACCGAGGACGGC
CACGGCGTGCGCCTGCATCCCAAGCCAACGGTCGTCGGCACGCTGAGCGCGATCGTGGTCAGCGACGGCG
ACCCGGTGCAGTCCGACCGCGACCACCGGATCAAGGTGCAGTTCCCGTTCCAGCGCGGGGCCGACGCCAG
CAGCGCGCTGGCGCATCCGGGGGGCGAGGACAACGCGCCGGGCAGCGCCTCGGCGTGGACCTGGGTGCGG
GTGATGACGCCGTGGGCCGGGGACAACTGGGGCGGCGTGGTGCTGCCGCGCAAGGGCCAGGAAGTGCTTG
TGGGGTTCCTGGAAGGGGACATCGACCGGCCGGTGGTGATCGGCAGCGTGTACAACGGGCGCGGCCAGGA
CGACGCGGCGCACAACCAGGTCGGCGGCGGCGGGGCCGGGGCCACCGGCAATGCGCCGGCGTGGTTCCAG
GGCAATGCGCACGGCGCGGTGTTCACCGGGTTCAAGAGCCAGGCGCTGGCGCAGAGCCAGGACGGCACCG
GCGGCTACCAGCAGCTGCGGCTGGACGACACGCCCGGCCAGGGCCGCGCGCAGCTGTCGACCACCCAGCA
CGCCAGCAGCTTGACCCTGGGCCACCTGAAGGGCGGCCACGACAACCTGCGCGAAGGCGAGCGCGGGTAC
GGGGCGGACCTGTCCACGCAGGCCTACGGCGCGGTGCGCGCCGGCCAGGGCCTGCTGCTGAGCAGCGAGC
CGGGCAACACCCAACTGGCCGCCACCGGCGCGCTGAGCCAACTGCAGCAGGGCAGCGACCTGCTCAAGCG
CCTCAACGACGCCGCCCGCACCCAGCAGGCGGGCCTACCGAGCGAACCGGAGTCCCTGCCGACCCAGGAC
GGCCTGAAGACCTTGCAGGACCACCTGCAGGCCACCCACAGCGGCAGCGCGGCCGGCGCGATCGGCGGTG
GTGCCGGCGAGGTGCCCGGCTGGAGCGCCCCAGTGCTGCTGGGCAGCGGCCAGGCCGGCGTGATGAGCCT
GACCCCGGCCGATCAGGTGTGGGTCTCGGGCACCCAGACCGCGCTGCTGGCCGGCAGCGCACTGAACTGG
CTGAGCCAGGGCCACCTGGTGCTGGCGGTGGCCGGCGGGCTGGTGCTGTACACCCAGGGCAGCGACCCGG
TCGCCGGCAGCCCCAACCAGGAGCGCGGCATCGCCCTGCACGCCGCGCAAGGCACGCTCAGCGCCCGCGC
GCACAGGAGCACCGCCACCCTGGCCGCCAAGACCCAGGTGCGCATCGTCAGCACCACCGCCGACGTCCAG
CTCGCCGCGCCGACCAAGCACCTGCTGGCCACCGCGGCCGGCGCCTACATCAAGCTGGACGGCGACGACA
TCGAACTGGGCGCGCCGGGGGTGGTCGCGTTCAAGGGCGGGCAGCAGGTGTTGACCGGGCCGCAGGGGGC
GAGCGTTTCGACTGACATCCCGAAAGGCAATTTCAAGGGCTGCGAGCCTAACGTTATGAATGCTTTGGCT
CGCTACGACGCCACTGCGAAGATCGAGTAG