SecReT6
Protein ID: 384418360
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1370
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1363386..1365383 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDG7TI33
KEGG IDxor:XOC_1370
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 1.10E-37, Aligned region: 390..410
DUF2345 [PF10106], Evalue: 1.10E-37, Aligned region: 471..634
T6SS_Vgr [PF13296], Evalue: 3.90E-27, Aligned region: 41..71
T6SS_Vgr [PF13296], Evalue: 3.90E-27, Aligned region: 327..431
T6SS_Vgr [PF13296], Evalue: 3.90E-27, Aligned region: 554..570
Phage_base_V [PF04717], Evalue: 4.20E-20, Aligned region: 182..285
Phage_GPD [PF05954], Evalue: 2.00E-11, Aligned region: 33..103
Phage_GPD [PF05954], Evalue: 2.00E-11, Aligned region: 347..383
Phage_GPD [PF05954], Evalue: 2.00E-11, Aligned region: 556..600
Protein Sequence: 665 a.a.     [Download]
>gi|384418360|ref|YP_005627720.1| Rhs element Vgr protein [Xanthomonas oryzae pv. oryzicola BLS256]
MGPIYCSAASARSLAGADATPLGDIGAEDVDTAGPYGWQDSTRGQRRAQQHLDAQQVTAQTIQGQGTWRQ
LAPGTRFGLRQHAVVAADAAFLCLQVRHQARNNLGAEVFDALEQALGAVAVAGAPLPPALAGLSGGYVPA
QDEAAVEFYRNQFTAIPATATYRPQTEDGHGVRLHPKPTVVGTLSAIVVSDGDPVQSDRDHRIKVQFPFQ
RGADASSALAHPGGEDNAPGSASAWTWVRVMTPWAGDNWGGVVLPRKGQEVLVGFLEGDIDRPVVIGSVY
NGRGQDDAAHNQVGGGGAGATGNAPAWFQGNAHGAVFTGFKSQALAQSQDGTGGYQQLRLDDTPGQGRAQ
LSTTQHASSLTLGHLKGGHDNLREGERGYGADLSTQAYGAVRAGQGLLLSSEPGNTQLAATGALSQLQQG
SDLLKRLNDAARTQQAGLPSEPESLPTQDGLKTLQDHLQATHSGSAAGAIGGGTGEVPGWSAPVLLGSGQ
AGVMSLTPADQVWVSGTQTALLAGSALNWLSQGHLVLAVAGGLVLYTQGSDPVAGSPNQERGIALHAAQG
TLSARAHRSTATLAAKTQVRIVSTTADVQLAAPTKHLLATAAGAYIKLDGDDIELGAPGVVAFKGGQQVL
TGPQGATSNAVVPNATLKPCPQDTTAKAAGGAAYI
 
Nucleotide Sequence: 1998 bp     [Download]
>gi|384417079|ref|NC_017267.1|:1363386-1365383 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGGGGCCAATATATTGCAGTGCCGCCAGCGCTCGCAGCCTGGCCGGTGCCGACGCCACGCCGCTGGGCG
ACATCGGTGCCGAGGACGTGGACACCGCCGGCCCCTACGGCTGGCAGGACAGCACCCGCGGCCAGCGCCG
CGCGCAGCAGCATCTGGATGCGCAGCAGGTGACGGCGCAGACCATCCAGGGCCAGGGGACCTGGCGGCAA
CTGGCACCGGGCACGCGTTTCGGGCTGCGCCAGCATGCGGTCGTGGCGGCCGATGCGGCGTTCCTGTGCC
TGCAGGTGCGGCACCAGGCGCGCAACAATCTGGGCGCGGAGGTGTTCGACGCGCTGGAGCAGGCGCTGGG
CGCGGTGGCGGTGGCCGGCGCGCCGCTGCCGCCGGCGCTGGCAGGCCTGAGCGGCGGGTATGTGCCGGCG
CAGGATGAGGCGGCGGTAGAGTTCTACCGCAACCAGTTCACCGCCATACCGGCCACCGCGACCTACCGGC
CGCAAACCGAGGACGGCCACGGCGTGCGCCTGCATCCCAAGCCAACGGTCGTCGGCACGCTGAGCGCGAT
CGTGGTCAGCGACGGCGACCCGGTGCAGTCCGACCGCGACCACCGGATCAAGGTGCAGTTCCCGTTCCAG
CGCGGGGCCGACGCCAGCAGCGCGCTGGCGCATCCGGGGGGCGAGGACAACGCGCCGGGCAGTGCCTCGG
CGTGGACCTGGGTGCGGGTGATGACGCCGTGGGCCGGGGACAACTGGGGCGGCGTGGTGCTGCCGCGCAA
GGGCCAGGAAGTGCTGGTGGGGTTCCTGGAAGGGGACATCGACCGGCCGGTGGTGATCGGCAGCGTGTAC
AACGGGCGCGGCCAGGACGACGCGGCGCACAACCAGGTCGGCGGCGGCGGGGCCGGAGCCACCGGCAATG
CGCCGGCGTGGTTCCAGGGCAACGCGCACGGCGCGGTGTTCACCGGGTTCAAGAGCCAGGCGCTGGCGCA
GAGCCAGGACGGCACCGGCGGCTACCAGCAGCTGCGGCTGGACGACACGCCCGGCCAGGGCCGCGCGCAG
CTGTCGACCACCCAGCACGCCAGCAGCTTGACCCTGGGCCACCTGAAGGGCGGCCACGACAACCTGCGCG
AAGGCGAGCGCGGGTACGGGGCGGACCTGTCCACGCAGGCCTACGGCGCGGTGCGCGCCGGCCAGGGCCT
GCTGCTGAGCAGCGAGCCGGGCAACACCCAACTGGCCGCCACCGGCGCGCTGAGCCAACTGCAGCAGGGC
AGCGACCTGCTCAAGCGCCTCAACGACGCCGCCCGCACCCAGCAGGCGGGCCTACCGAGCGAACCGGAGT
CCCTGCCGACCCAGGACGGCCTGAAGACCTTGCAGGACCACCTGCAGGCCACCCACAGCGGCAGCGCGGC
CGGCGCGATCGGCGGTGGCACCGGCGAGGTGCCCGGCTGGAGCGCCCCAGTGCTGCTGGGCAGCGGCCAG
GCCGGCGTGATGAGCCTGACCCCGGCTGACCAGGTGTGGGTCTCGGGCACCCAGACCGCGCTGCTGGCCG
GCAGCGCACTGAACTGGCTCAGCCAGGGCCACCTGGTGCTGGCGGTGGCCGGCGGGCTGGTGCTGTACAC
CCAGGGCAGCGACCCGGTCGCCGGCAGCCCCAACCAGGAGCGCGGCATCGCCCTGCACGCCGCGCAAGGC
ACGCTCAGCGCCCGCGCGCACAGGAGCACCGCCACCCTGGCCGCCAAGACCCAGGTGCGCATCGTCAGCA
CCACCGCCGACGTCCAGCTCGCCGCGCCGACCAAGCACCTGCTGGCCACCGCAGCCGGCGCCTACATCAA
GCTGGACGGCGACGACATCGAACTGGGCGCGCCGGGGGTGGTCGCGTTCAAGGGCGGGCAGCAGGTGTTG
ACCGGGCCGCAGGGGGCGACCAGCAATGCTGTTGTGCCCAACGCTACGTTGAAGCCCTGCCCGCAGGACA
CCACGGCGAAGGCCGCTGGCGGCGCTGCGTACATCTAG