SecReT6
Protein ID: 384419455
SecReT6 ID595
T6SS typei3
Gene symbol-
Locus tagXOC_2529
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]2570953..2572269 [-]
ProductOmpA family membrane protein
NoteTssL
UniProt IDG7TGQ3
KEGG IDxor:XOC_2529
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.10E-65, Aligned region: 57..262
OmpA [PF00691], Evalue: 2.70E-15, Aligned region: 201..234
OmpA [PF00691], Evalue: 2.70E-15, Aligned region: 329..419
Protein Sequence: 438 a.a.     [Download]
>gi|384419455|ref|YP_005628815.1| OmpA family membrane protein [Xanthomonas oryzae pv. oryzicola BLS256]
MSNTVDQHDDDATVVRSATPAPRPAASMPPRQAPTRTRRPPDLDAAMRATPGAMQGNAVVRAATPLLLLA
VQLRHSAQTPEIATLRENCGTRLQRFEQELRQQGTDDKTGIAARYVLCTLLDEAVLAAPWGEASCWSQRT
LLVTFHGETYGGAKVFDLLDRLARDPARHLDLLELLYLALALGFGGRYRVEQGGGARLADRQAELYQLIQ
RQRVPAPAELSPHWQGAQAPLLRNAAATPLWIAALASLCIVLLAFVWLHARLNTLTAPISAQLARIGLER
VALPIPAAARAATIPALAPLLAAEQRAGLLTVHTDGDGRSTVRLASASMFPSGSAELDADQTHLLERVAA
ALEQVPGRVVVVGHTDDQPVRSLRFKDNFALSARRAESVGAVLAAGLRDRRRVQTSGAGDSQPIALPPQL
PGNRARNRRVEILLIPET
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c2572269-2570953 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGAGCAACACGGTCGACCAGCACGACGACGATGCCACCGTGGTCCGCAGCGCGACGCCGGCGCCGCGGC
CCGCCGCATCCATGCCGCCCCGCCAAGCACCGACGCGGACGAGGCGACCGCCCGATCTGGATGCCGCCAT
GCGCGCGACGCCAGGTGCGATGCAGGGCAATGCGGTGGTGCGCGCAGCCACGCCGCTGCTGCTGCTGGCG
GTTCAGTTGCGACACTCCGCGCAGACGCCGGAGATCGCCACCTTGCGCGAGAACTGCGGCACGCGCCTGC
AGCGCTTCGAGCAGGAGCTGCGGCAACAGGGCACCGACGACAAGACCGGCATCGCCGCGCGCTACGTGCT
GTGCACGTTGCTCGACGAAGCGGTACTGGCCGCGCCCTGGGGCGAGGCCAGCTGCTGGTCGCAGCGCACC
TTGCTGGTGACGTTCCACGGCGAAACCTATGGCGGCGCCAAGGTCTTCGACCTGCTTGATCGGCTGGCAC
GCGATCCGGCGCGGCACCTGGACCTGCTGGAGCTGCTGTACCTGGCATTGGCGCTGGGCTTTGGTGGCCG
CTATCGGGTGGAGCAGGGTGGCGGGGCACGGCTGGCCGATCGCCAGGCCGAGCTCTACCAACTCATCCAG
CGTCAGCGCGTGCCTGCGCCTGCCGAGTTGTCGCCGCATTGGCAAGGCGCGCAGGCGCCGTTGCTGCGCA
ATGCAGCGGCCACGCCGCTGTGGATCGCGGCGCTGGCCTCGCTGTGCATCGTGTTGCTGGCGTTCGTGTG
GTTGCATGCGCGCCTCAATACGCTGACCGCGCCGATCAGCGCGCAGCTGGCGCGCATCGGCCTGGAGCGG
GTGGCGTTGCCGATCCCGGCGGCAGCCAGAGCGGCGACCATACCGGCGCTTGCACCGCTGCTGGCGGCCG
AGCAACGCGCAGGGTTGCTGACCGTCCACACCGACGGCGATGGCCGCAGCACCGTGCGCCTGGCCAGCGC
ATCCATGTTCCCCAGCGGCAGCGCGGAGTTGGATGCCGATCAGACCCACCTGCTCGAACGCGTTGCTGCG
GCGCTTGAACAGGTGCCGGGGCGGGTGGTGGTGGTGGGGCATACCGACGATCAGCCGGTGCGCTCGCTGC
GCTTCAAGGACAACTTCGCCTTATCCGCACGTCGCGCCGAGAGCGTGGGCGCCGTGTTGGCGGCAGGCCT
GCGCGATCGACGCCGGGTACAGACCAGTGGCGCGGGCGATTCCCAGCCCATCGCGCTACCGCCGCAATTG
CCCGGCAACCGTGCGCGCAATCGGCGCGTCGAGATCCTGTTGATTCCCGAGACCTGA