SecReT6
Protein ID: 384419456
SecReT6 ID595
T6SS typei3
Gene symbol-
Locus tagXOC_2530
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]2572271..2573608 [-]
Productprotein ImpJ
NoteTssK
UniProt IDG7TGQ4
KEGG IDxor:XOC_2530
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.60E-151, Aligned region: 19..444
Protein Sequence: 445 a.a.     [Download]
>gi|384419456|ref|YP_005628816.1| protein ImpJ [Xanthomonas oryzae pv. oryzicola BLS256]
MSPYNKVIWSEGLFLRPQHLQQQERYLERYMELHAGALRPHAWGFSVLELEPELLSIGKLGIRRARGCFP
DGTPFSIPDRDPAPPPLDVPANCRDQVVSLALPLRATTQPDSTWPDGDGSRLARYRVGEAEVGDSSGSIA
GTVLLEVGVLASRLRLQSEPGEGLVEVPMARIVECRADRRVILDDAFIPTAIRIEGAARLSMLLAELLGL
LHQRGQALADRVAGSDRSGVAEIADVLMLQVINRYQPLVAHWASAPLEHPEALYCVLLGMAGELATFTRA
SKRSGPFPPYAHDALQASFEPVVVSLRESLSAVLEQSAIAVPLQQRKYGVWVGMVPDPALLDAAAFVLAV
KADLRAEDLRKRLPAESKIGPVEKIRDLVNLQLPGVAVSALAMAPRQVPYHAGCAYFELDRQSSLWKTLR
TSGGVALHFGSGFPGLELELWAVRN
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c2573608-2572271 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGAGCCCTTACAACAAGGTGATCTGGAGCGAGGGCCTGTTCCTGCGCCCGCAGCACCTGCAACAACAGG
AGCGCTATCTGGAGCGCTACATGGAACTGCATGCCGGTGCGCTCCGGCCGCATGCGTGGGGTTTCAGCGT
ACTGGAGCTGGAGCCGGAATTGCTGTCCATCGGCAAGCTCGGCATCCGGCGCGCCCGCGGCTGCTTTCCC
GATGGCACGCCGTTTTCCATTCCCGATCGCGATCCGGCACCGCCGCCGTTGGACGTGCCGGCCAACTGCC
GCGACCAGGTGGTGAGTCTGGCGCTGCCGCTGCGCGCGACCACGCAGCCGGATAGCACCTGGCCGGATGG
CGACGGCAGCCGGCTGGCCCGTTATCGCGTGGGCGAAGCGGAGGTCGGCGATTCGTCCGGCAGCATCGCC
GGCACGGTCCTGCTGGAAGTCGGCGTGCTGGCCAGTCGCCTACGCCTGCAGTCCGAACCGGGGGAGGGGC
TGGTGGAGGTGCCGATGGCGCGCATTGTCGAGTGCCGCGCCGATCGACGGGTGATTCTCGATGATGCCTT
CATCCCGACCGCCATCCGCATCGAAGGCGCCGCGCGGTTGTCCATGCTGCTGGCCGAATTGCTTGGGCTA
TTGCATCAACGCGGCCAGGCGCTGGCCGACCGCGTGGCCGGCAGCGACCGTAGCGGCGTGGCGGAAATCG
CAGACGTGCTGATGTTGCAGGTGATCAATCGCTACCAGCCGCTGGTGGCGCATTGGGCAAGCGCGCCGCT
GGAGCATCCCGAAGCGCTGTATTGCGTGCTGCTGGGGATGGCTGGCGAACTCGCGACCTTCACCCGTGCC
AGTAAACGCAGCGGGCCATTTCCGCCGTACGCACACGATGCGCTGCAGGCGAGCTTCGAGCCGGTGGTGG
TGTCCTTGCGCGAAAGCTTGAGCGCGGTGCTCGAACAGTCGGCGATTGCCGTGCCCTTGCAGCAACGCAA
ATACGGCGTGTGGGTGGGCATGGTGCCCGATCCGGCCTTGCTGGACGCGGCGGCCTTCGTGCTGGCAGTC
AAGGCGGATCTGCGCGCCGAGGATCTGCGCAAGCGGCTACCCGCCGAATCGAAGATCGGCCCGGTGGAGA
AGATTCGCGACCTGGTGAACCTGCAACTGCCCGGGGTGGCCGTGAGTGCGCTGGCGATGGCACCGCGGCA
GGTGCCGTATCACGCCGGCTGCGCCTACTTCGAACTCGATCGGCAATCGTCGCTGTGGAAGACGCTGCGC
ACGTCCGGTGGCGTGGCGCTGCATTTCGGCAGTGGTTTTCCCGGCCTGGAACTTGAGTTGTGGGCGGTGA
GGAATTGA