SecReT6
Protein ID: 384419457
SecReT6 ID595
T6SS typei3
Gene symbol-
Locus tagXOC_2531
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]2573605..2575002 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDG7TGQ5
KEGG IDxor:XOC_2531
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.70E-14, Aligned region: 31..94
Protein Sequence: 465 a.a.     [Download]
>gi|384419457|ref|YP_005628817.1| FHA domain-containing protein [Xanthomonas oryzae pv. oryzicola BLS256]
MSPRLTLTVRDAQAVSGGTQVQASFAAEGGRIGRDATCDWVLEGEGVSRLHASVRHLDGVYFIEDHSTNG
VLHNGVPLRAGFPVPLHAGDALRIDAFEIDVAVSGASVTAVAAATQNWNHAEPCTLSAMPLPQQSQHAPL
EHDVFAALGASSMRATDTDPLALFATSFTLAGRQSDAAAFGLGHAPATAEAYRAPVAAPAAGGVVLPEHW
DLTRSEFALPPAADPVADMQAPLPSAAVPIAAAAAAPAPTPTPTPLPLPLPLPTPVSQTRGAAVAVSAAA
PSAAQPVVAHTPDTPELPALFAAMTAGLMDVLRARAAFKNSLRVPVTLIQRTENNPLKFAATVDEAVARL
LAPPSPGYLTGAAAIEEAVEDIGRHQLALLAGMRAAFEHVFAQFDPARFEADTAGSALGSWGNRPWRRYA
QHYRELLGDPDERFRRLFGEEFARAYEQQLARAKAQAQPTDGDRA
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c2575002-2573605 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
GTGTCACCCCGGCTGACGCTGACGGTTCGCGATGCGCAGGCGGTGTCGGGCGGCACACAAGTGCAGGCCA
GCTTCGCGGCAGAAGGCGGGCGCATCGGCCGCGACGCCACCTGCGATTGGGTGCTCGAAGGCGAGGGGGT
GTCGCGCCTGCACGCCAGCGTGCGCCATCTCGATGGGGTGTATTTCATCGAAGACCACAGCACTAACGGC
GTGTTGCATAACGGCGTGCCGCTACGTGCCGGTTTTCCGGTGCCGCTGCATGCCGGCGACGCCTTGCGCA
TCGATGCCTTCGAGATCGACGTGGCGGTGTCGGGCGCAAGCGTTACCGCTGTTGCAGCCGCGACGCAGAA
CTGGAATCACGCCGAACCGTGCACGCTGTCGGCAATGCCACTGCCGCAGCAGTCGCAGCACGCGCCGCTG
GAGCATGATGTTTTCGCCGCGCTTGGGGCGTCGTCGATGCGGGCAACCGACACCGACCCACTGGCATTGT
TCGCCACCTCGTTCACGCTGGCCGGCCGCCAGAGCGATGCGGCGGCGTTCGGGCTGGGGCATGCGCCGGC
AACGGCCGAGGCCTACCGTGCACCCGTGGCCGCGCCGGCTGCCGGCGGCGTTGTGTTGCCCGAGCACTGG
GACCTGACACGCAGCGAATTTGCGCTGCCGCCGGCTGCCGATCCAGTGGCAGACATGCAAGCGCCACTGC
CGTCCGCCGCAGTGCCTATTGCCGCAGCGGCGGCAGCACCCGCACCGACGCCCACACCCACACCATTGCC
ACTGCCACTGCCACTGCCAACGCCGGTCTCGCAAACGCGTGGCGCGGCAGTAGCGGTGAGCGCTGCCGCC
CCCTCCGCGGCGCAGCCGGTAGTTGCACACACGCCGGATACCCCCGAGCTGCCTGCGCTGTTCGCCGCCA
TGACCGCTGGCTTGATGGATGTCTTGCGCGCGCGTGCGGCGTTCAAGAACAGCCTGCGCGTGCCGGTCAC
GCTGATCCAACGCACCGAGAACAATCCGCTCAAGTTCGCCGCGACGGTGGACGAGGCGGTCGCCCGCCTG
TTGGCGCCGCCGAGCCCTGGGTATCTGACCGGTGCGGCCGCGATCGAAGAAGCGGTGGAGGACATCGGGC
GTCACCAGCTGGCCTTGTTGGCCGGCATGCGTGCCGCCTTCGAGCATGTGTTTGCCCAGTTCGATCCAGC
GCGCTTCGAGGCAGACACCGCCGGCTCCGCGCTCGGTTCCTGGGGCAATCGGCCCTGGCGACGCTACGCG
CAGCATTACCGCGAGTTGCTCGGCGATCCCGACGAGCGCTTCCGCCGCCTGTTCGGCGAAGAATTCGCCC
GCGCCTACGAACAACAGCTGGCCCGTGCCAAGGCGCAGGCTCAACCCACAGACGGCGACCGAGCATGA