SecReT6
Protein ID: 384419459
SecReT6 ID595
T6SS typei3
Gene symbol-
Locus tagXOC_2533
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]2575556..2577634 [-]
ProductRhs-family protein
NoteTssI
UniProt IDG7TGQ7
KEGG IDxor:XOC_2533
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-73, Aligned region: 70..375
Phage_base_V [PF04717], Evalue: 3.00E-21, Aligned region: 417..510
Protein Sequence: 692 a.a.     [Download]
>gi|384419459|ref|YP_005628819.1| Rhs-family protein [Xanthomonas oryzae pv. oryzicola BLS256]
MSAVTYSSPACVASRFSISCAPGRPAKSSHAIDLCAYVPQDHSGSLTMAHAITLQSPLGKTLRFVRMSAH
EALGRPYAFALHGISRDVAIDLRALLGKPMAVKITSPQGYVRHYHGIVAEAEQTGFEQIEGLRYATYAFS
LVPKLWLLGQRRDCRIYKNKSVPELVRALLAEVGCTDVKLRLSASYTPREYCVQYRESALDFISRLMEQE
GIYYYFAHSASTHTLVLADSLGAHESSAPFAQIPYCPPGQKGSRMKDAITDWSLARSAHSTRVRLDDYDY
LKPKASLRVDETPAESSGPALGELDVFDYPGEHLDVAAGRRHAQVRAEALNVAQAQYQGWTDACGLQVGA
LFKLRDFPLAEHNQEYLVTSADTELVEVDYVSGGQTVAEPFASTFRALRSRQPFRTPQTTPRPSIAGVQT
ALVDGNKAEDIAVDQYGRVQVNFFWSPPGTPNAVCSCPVRVAQSWAGKRWGAQHIPRVGQEVVVSFLEGN
PDRPLIIGSVYNADQLPPYALPEHRTRSGVKSRSLSGGAEDYNEIRFDDKKGNEELLLHAQRDLRHEAEN
DHFVTVDRNETAEIKRERSHTVGGNDRLDVGKTLRIQAGSEIALVTGMARLQLKASGEIVLSGTRLTLDG
RVSVGIQGGVSVDVSAMANLTLRSNASVLLQSNAVTTARANAALLLQSSGPAVLKGTPPIIA
 
Nucleotide Sequence: 2079 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c2577634-2575556 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
GTGAGCGCGGTGACCTACTCCTCCCCGGCATGTGTGGCATCGCGATTTTCGATTTCCTGCGCGCCAGGGC
GGCCGGCAAAGTCATCGCATGCCATCGACCTTTGCGCCTATGTACCGCAAGACCACTCCGGGAGCCTGAC
CATGGCCCACGCCATTACCCTGCAGTCGCCGCTTGGCAAGACGCTGCGCTTTGTGCGGATGAGCGCGCAC
GAGGCGCTGGGGCGGCCCTATGCGTTCGCGTTGCACGGCATCAGCCGCGATGTGGCGATCGACCTGCGCG
CTCTACTGGGCAAGCCGATGGCGGTCAAGATCACTTCACCGCAGGGCTATGTGCGGCATTACCACGGCAT
CGTCGCCGAGGCGGAGCAGACCGGGTTCGAGCAGATCGAGGGGCTGCGCTACGCCACCTATGCCTTCTCG
CTGGTGCCCAAGCTGTGGTTGCTCGGGCAGCGCCGCGATTGCCGCATCTACAAGAACAAGAGCGTGCCGG
AGCTGGTGCGCGCGTTGCTGGCCGAGGTTGGATGCACCGACGTGAAGCTGCGCCTGAGCGCGAGCTACAC
GCCGCGCGAATACTGCGTGCAGTACCGCGAGAGCGCGCTGGACTTCATCAGCCGCTTGATGGAGCAAGAG
GGCATCTACTACTACTTCGCACACAGTGCCAGCACGCATACGCTGGTGCTGGCCGACAGTCTCGGCGCGC
ACGAATCCTCTGCGCCATTCGCACAAATCCCTTACTGCCCGCCCGGGCAGAAGGGCAGCCGGATGAAGGA
CGCGATCACCGATTGGTCGCTGGCGCGCAGCGCGCACAGCACGCGCGTGCGCCTGGACGACTACGACTAT
CTCAAGCCCAAGGCCTCGCTGCGGGTGGACGAGACACCGGCCGAGTCTTCGGGACCGGCGCTGGGCGAGC
TGGATGTGTTCGATTATCCCGGCGAGCATCTCGATGTCGCGGCCGGTCGTCGTCACGCGCAGGTGCGTGC
CGAAGCGCTCAACGTGGCGCAGGCGCAATACCAGGGCTGGACCGATGCCTGCGGTTTGCAGGTGGGCGCA
TTGTTCAAGCTGCGCGACTTTCCGCTGGCCGAGCACAACCAGGAATACCTGGTGACCAGCGCGGACACCG
AACTGGTTGAAGTGGATTATGTGTCCGGTGGCCAGACGGTTGCCGAGCCGTTTGCGTCCACCTTCCGTGC
GCTACGCAGTCGGCAGCCGTTTCGCACCCCGCAGACCACGCCGCGTCCGAGTATTGCCGGGGTGCAGACC
GCGCTCGTCGACGGCAACAAGGCCGAGGATATTGCGGTCGATCAGTACGGCCGTGTGCAGGTGAATTTCT
TCTGGAGTCCGCCGGGAACGCCAAACGCCGTCTGCTCGTGCCCGGTACGCGTGGCGCAGTCGTGGGCGGG
CAAACGCTGGGGCGCGCAGCACATTCCGCGTGTGGGCCAGGAGGTGGTGGTGAGCTTTCTGGAAGGCAAT
CCGGATCGTCCGCTGATCATCGGCAGCGTCTACAACGCCGACCAGCTGCCACCGTATGCACTGCCCGAGC
ACCGCACCCGTAGCGGGGTAAAGAGCCGCAGCCTGTCGGGTGGGGCAGAGGACTACAACGAGATCCGTTT
CGACGACAAGAAGGGCAACGAAGAGCTGCTGCTGCATGCGCAGCGCGATCTGCGCCACGAAGCGGAGAAC
GACCATTTCGTCACTGTCGACCGCAACGAAACCGCCGAGATCAAACGCGAACGCAGCCACACCGTTGGCG
GCAACGACCGTCTGGACGTGGGCAAGACACTCCGCATCCAGGCAGGGAGCGAGATCGCGTTGGTGACCGG
GATGGCTCGCCTGCAGTTGAAGGCCAGCGGCGAGATCGTGCTCAGCGGCACCCGGCTCACGCTCGATGGA
CGCGTCAGCGTCGGTATCCAGGGTGGCGTCAGTGTCGATGTCAGCGCGATGGCCAACCTGACCCTGCGCT
CGAACGCGTCGGTGCTGCTGCAATCCAACGCCGTGACCACCGCGCGCGCCAACGCGGCGCTGCTGTTGCA
GTCGTCCGGTCCGGCCGTGCTCAAGGGCACTCCGCCCATCATCGCTTGA