SecReT6
Protein ID: 384419463
SecReT6 ID595
T6SS typei3
Gene symbol-
Locus tagXOC_2537
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]2580934..2583639 [-]
Productchaperone ClpB
NoteTssH
UniProt IDG7TGR1
KEGG IDxor:XOC_2537
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.80E-40, Aligned region: 225..244
AAA_2 [PF07724], Evalue: 3.80E-40, Aligned region: 633..799
AAA [PF00004], Evalue: 2.90E-17, Aligned region: 225..337
AAA [PF00004], Evalue: 2.90E-17, Aligned region: 639..723
ClpB_D2-small [PF10431], Evalue: 1.00E-14, Aligned region: 806..881
AAA_16 [PF13191], Evalue: 1.80E-12, Aligned region: 126..167
AAA_16 [PF13191], Evalue: 1.80E-12, Aligned region: 202..248
AAA_16 [PF13191], Evalue: 1.80E-12, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 1.80E-12, Aligned region: 609..681
AAA_16 [PF13191], Evalue: 1.80E-12, Aligned region: 703..725
AAA_5 [PF07728], Evalue: 5.50E-12, Aligned region: 225..245
AAA_5 [PF07728], Evalue: 5.50E-12, Aligned region: 638..756
Sigma54_activat [PF00158], Evalue: 4.20E-07, Aligned region: 203..247
Sigma54_activat [PF00158], Evalue: 4.20E-07, Aligned region: 637..751
Zeta_toxin [PF06414], Evalue: 8.50E-06, Aligned region: 224..247
Zeta_toxin [PF06414], Evalue: 8.50E-06, Aligned region: 637..678
Zeta_toxin [PF06414], Evalue: 8.50E-06, Aligned region: 811..843
AAA_22 [PF13401], Evalue: 1.20E-05, Aligned region: 224..248
AAA_22 [PF13401], Evalue: 1.20E-05, Aligned region: 357..391
AAA_22 [PF13401], Evalue: 1.20E-05, Aligned region: 636..661
AAA_22 [PF13401], Evalue: 1.20E-05, Aligned region: 700..722
AAA_14 [PF13173], Evalue: 5.20E-05, Aligned region: 225..293
AAA_14 [PF13173], Evalue: 5.20E-05, Aligned region: 331..391
AAA_14 [PF13173], Evalue: 5.20E-05, Aligned region: 637..748
NACHT [PF05729], Evalue: 5.20E-05, Aligned region: 225..253
NACHT [PF05729], Evalue: 5.20E-05, Aligned region: 638..665
AAA_17 [PF13207], Evalue: 6.90E-05, Aligned region: 225..249
AAA_17 [PF13207], Evalue: 6.90E-05, Aligned region: 500..546
AAA_17 [PF13207], Evalue: 6.90E-05, Aligned region: 638..676
AAA_19 [PF13245], Evalue: 0.00014, Aligned region: 222..249
AAA_19 [PF13245], Evalue: 0.00014, Aligned region: 636..660
AAA_25 [PF13481], Evalue: 0.00018, Aligned region: 220..301
AAA_25 [PF13481], Evalue: 0.00018, Aligned region: 351..391
AAA_25 [PF13481], Evalue: 0.00018, Aligned region: 636..663
Arch_ATPase [PF01637], Evalue: 0.00054, Aligned region: 203..245
Arch_ATPase [PF01637], Evalue: 0.00054, Aligned region: 637..679
Arch_ATPase [PF01637], Evalue: 0.00054, Aligned region: 704..720
IstB_IS21 [PF01695], Evalue: 0.0012, Aligned region: 218..247
IstB_IS21 [PF01695], Evalue: 0.0012, Aligned region: 638..657
AAA_18 [PF13238], Evalue: 0.0019, Aligned region: 225..245
AAA_18 [PF13238], Evalue: 0.0019, Aligned region: 639..669
AAA_29 [PF13555], Evalue: 0.0058, Aligned region: 217..240
AAA_29 [PF13555], Evalue: 0.0058, Aligned region: 636..663
DUF815 [PF05673], Evalue: 0.0068, Aligned region: 215..300
DUF815 [PF05673], Evalue: 0.0068, Aligned region: 637..676
Protein Sequence: 901 a.a.     [Download]
>gi|384419463|ref|YP_005628823.1| chaperone ClpB [Xanthomonas oryzae pv. oryzicola BLS256]
MADISRAALFGKLNKTTYRGIESATAFCRLRGDREVELLHWLHQLLQAQDGDLHRIVRRFSLDASRLAQD
LTVALDRLPRGGGGHFDLSASVEEAVERAWVHCTLRYGRQRIRGGDLLVAILHTRSLRHGLLAMSSEFAK
LRAEALADDLDDIVAGSPEDDATDVAAAVAPVGTGAAGGTAALALYTVDLTAQAREGKLDPIIGRDDEIR
QVVDILMRRRQNNPILVGEAGVGKTAVVEGFAQRIARGDVPPALQDVQLRTLDVGLLQAGASMKGEFEQR
LRAVIDEVQASPKPIILFVDETHTLVGAGGAAGTGDAANLLKPALARGTLRTVGATTFAEYKKYIEKDPA
LTRRFQAVQVDEPDEAKAVRMMRGVASTMEQHHRVQILDEALEAAVKLSHRYIPARQLPDKSVSLLDTAC
ARVAVSLHATPAEVDDSRRRIESLDTEHAIIERERAIGIVVDERAAACASLLQSEHGRLRELEQRWVAEK
ALVDALLSLRAQLRGGNAPVEGTGSALETEAEQRASGDIAVLETPVHVDRDALLARLQLVQAELAALQGE
SPLILPTVDYQAVAAVVADWTGIPVGRMARNEIDTVLRLPELLAKRVIGQDHAMEMIAKRIQTSRAGLDN
PDKPIGVFLLAGTSGVGKTETALALAETLYGGEQNLITINMSEYQEAHTVSSLKGAPPGYVGYGEGGVLT
EAVRRKPYAVVLLDEVEKAHPDVHELFFQVFDKGWMEDGEGRRIDFRNTLIILTSNAGTDLIASLCKDPE
LMPDPDGMAKALREPLLKVFPPALLGRLVAIPYYPLSNAMLGQIVRLQLNRIKQRIEERYRIPFDYDESV
VELVVSRCTESESGGRMIDAILTNSMLPEISRKFLRGVVDRKRTERLDIRVEDSALVYSFL
 
Nucleotide Sequence: 2706 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c2583639-2580934 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGGCAGACATCAGTCGCGCCGCCTTGTTCGGCAAGCTCAACAAGACCACCTATCGCGGTATCGAATCGG
CCACTGCGTTCTGCAGGCTACGTGGCGACCGCGAAGTGGAACTGCTGCACTGGCTGCATCAGTTGCTGCA
GGCGCAAGACGGCGACTTGCACCGCATCGTGCGCCGTTTTTCGCTGGATGCGTCGCGGCTTGCACAGGAC
CTGACCGTGGCGCTCGATCGCCTGCCGCGCGGCGGTGGCGGACACTTCGATCTGTCGGCCAGCGTGGAGG
AGGCAGTGGAACGCGCCTGGGTGCACTGCACGTTGCGTTACGGGCGGCAACGCATCCGTGGCGGCGATCT
GCTGGTGGCGATCCTGCATACGCGCAGCCTGCGTCACGGGTTGCTGGCGATGTCGAGCGAGTTCGCCAAG
CTGCGCGCGGAAGCACTGGCGGACGATCTGGATGACATCGTCGCCGGCTCGCCGGAAGACGATGCCACCG
ACGTTGCGGCGGCTGTCGCCCCCGTTGGGACTGGCGCAGCAGGTGGTACTGCCGCGCTCGCGCTGTATAC
GGTCGATCTCACCGCGCAGGCACGCGAGGGCAAGCTGGACCCGATCATCGGCCGCGACGACGAGATTCGC
CAGGTCGTCGATATCCTGATGCGGCGCCGCCAGAACAACCCGATCCTGGTTGGCGAGGCCGGTGTCGGCA
AGACCGCGGTGGTGGAAGGCTTCGCACAACGTATCGCGCGCGGCGATGTGCCGCCCGCGTTGCAGGATGT
GCAGCTGCGCACGCTGGATGTCGGCTTGCTGCAAGCCGGCGCCAGCATGAAAGGTGAGTTCGAGCAGCGC
CTGCGCGCAGTCATCGACGAAGTGCAGGCCAGCCCCAAGCCGATCATTCTGTTCGTGGATGAAACCCACA
CCCTGGTCGGCGCCGGTGGCGCGGCCGGTACCGGCGATGCGGCCAACCTGCTCAAGCCCGCACTGGCGCG
CGGCACCTTGCGCACCGTGGGTGCCACCACGTTTGCCGAGTACAAGAAGTACATCGAAAAAGACCCCGCA
CTGACACGACGCTTCCAGGCCGTGCAGGTCGACGAACCGGACGAGGCCAAGGCGGTGCGCATGATGCGCG
GTGTCGCCTCGACGATGGAACAGCACCACCGCGTACAGATTCTGGACGAGGCGCTGGAAGCGGCGGTCAA
GCTCAGTCACCGCTATATCCCGGCGCGCCAGCTGCCAGACAAATCGGTCAGTCTGCTCGATACCGCCTGC
GCGCGCGTCGCGGTGAGCCTGCATGCCACGCCTGCGGAAGTGGACGACAGCCGTCGCCGCATCGAATCGC
TGGACACCGAGCACGCCATCATCGAGCGCGAGCGTGCGATTGGCATCGTGGTCGATGAGCGTGCTGCCGC
TTGCGCCAGCCTGCTGCAAAGCGAGCACGGCCGCCTGCGCGAGCTGGAACAGCGCTGGGTTGCCGAAAAG
GCGTTGGTCGATGCGCTGTTGTCGCTACGCGCGCAACTGCGAGGCGGCAACGCGCCGGTGGAAGGGACCG
GCAGTGCGTTGGAAACGGAGGCCGAACAGCGTGCGTCTGGCGATATCGCGGTGCTCGAAACGCCGGTACA
CGTGGATCGCGATGCGCTCTTAGCACGTTTGCAGTTGGTACAAGCCGAACTGGCCGCATTGCAGGGCGAA
TCGCCGCTGATCCTGCCCACCGTCGATTACCAAGCCGTGGCCGCGGTGGTCGCCGACTGGACCGGCATCC
CGGTCGGGCGCATGGCCCGCAACGAGATCGACACCGTGCTGCGCTTGCCCGAACTGCTGGCCAAGCGCGT
GATCGGCCAGGACCACGCCATGGAGATGATCGCCAAGCGGATCCAGACCAGCCGCGCCGGCCTGGACAAC
CCGGACAAACCGATCGGCGTGTTCCTGCTGGCCGGAACCTCCGGCGTGGGCAAGACCGAAACCGCACTCG
CCCTGGCCGAAACGCTGTACGGCGGCGAGCAAAACCTGATCACCATCAACATGAGCGAGTACCAAGAGGC
GCACACCGTCTCCTCGCTCAAGGGCGCACCGCCGGGCTATGTGGGCTACGGCGAAGGTGGCGTACTGACC
GAAGCGGTGCGACGCAAGCCGTACGCGGTCGTGCTGCTGGACGAAGTGGAAAAAGCCCACCCGGACGTGC
ACGAACTGTTCTTCCAGGTCTTCGACAAGGGCTGGATGGAAGACGGCGAAGGCCGCCGCATCGACTTCCG
CAACACCTTGATCATCCTTACCAGCAACGCCGGCACCGACCTGATCGCCAGCCTGTGCAAGGACCCGGAA
TTGATGCCGGATCCGGACGGCATGGCCAAGGCATTGCGCGAACCGTTGTTGAAGGTGTTTCCGCCGGCAT
TGCTCGGGCGGCTGGTGGCGATTCCGTATTACCCGCTCAGTAACGCCATGCTCGGACAGATCGTGCGATT
GCAGTTGAACCGCATCAAGCAGCGGATCGAAGAGCGCTACAGGATTCCGTTCGACTACGACGAGTCTGTA
GTGGAGCTGGTGGTGAGCCGGTGTACCGAGAGCGAATCGGGTGGCCGGATGATCGATGCGATTTTGACTA
ACTCGATGTTGCCGGAGATTAGCCGCAAATTTCTTCGTGGGGTAGTGGACCGGAAACGGACTGAACGCCT
TGACATTCGTGTCGAAGATTCCGCATTGGTTTATTCGTTTCTCTGA