SecReT6
Protein ID: 384419464
SecReT6 ID595
T6SS typei3
Gene symbol-
Locus tagXOC_2538
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]2583672..2584682 [-]
Producthypothetical protein
NoteTssG
UniProt IDG7TGR2
KEGG IDxor:XOC_2538
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.70E-109, Aligned region: 20..321
Protein Sequence: 336 a.a.     [Download]
>gi|384419464|ref|YP_005628824.1| hypothetical protein XOC_2538 [Xanthomonas oryzae pv. oryzicola BLS256]
MASPSRQSADPVALFARLDAQPQAFELFEALRWLECAHPAQPRLGQAARPLEEPVRLGQRASLEFPPRDI
DSVHAGVDGRPPTLRTLSLGLFGPHGALPLHLTEHAIERESAGDPTFAAFADMFHHRMIALWYRAWADAR
PTVQMDRVGDDRFGARLDALTGVDQPALRDRDAMPVAARRHFAGRFVAQARNAEGLRAVLTGLFDVPVQV
QELVANWLTLPEEGRLRMGRAAARIGRDATLGASARNAQHRFRLRIGPLEIARYREFLPGGQALDVLTAA
VRGYIGDEQAWDLQLVLAREDVPLPVLGQGQRIGLSLWLGHYRRPLDADQLVLTSP
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c2584682-2583672 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGGCCAGCCCATCTCGGCAATCGGCCGATCCTGTAGCGCTGTTCGCGCGGCTGGATGCGCAACCGCAGG
CCTTCGAGCTATTCGAAGCGCTGCGGTGGCTGGAGTGCGCGCATCCGGCGCAACCGCGTCTGGGCCAGGC
AGCACGGCCGTTGGAAGAGCCTGTGCGTTTGGGCCAGCGCGCCTCGCTGGAATTTCCTCCGCGCGACATC
GACAGCGTGCACGCTGGCGTTGACGGTCGCCCGCCGACCCTGCGCACGCTGTCGCTGGGCTTGTTCGGCC
CGCATGGTGCGCTGCCGTTGCACCTGACCGAGCACGCCATCGAACGTGAAAGCGCTGGCGATCCCACCTT
TGCGGCCTTTGCCGACATGTTTCACCATCGCATGATTGCGCTGTGGTATCGCGCCTGGGCCGATGCGCGA
CCCACCGTGCAGATGGATCGCGTGGGCGATGACCGCTTCGGCGCGCGGCTGGATGCGTTAACCGGTGTGG
ACCAACCTGCGTTACGTGATCGCGATGCGATGCCGGTGGCTGCACGCCGCCACTTCGCCGGTCGCTTCGT
TGCCCAGGCGCGCAATGCGGAAGGCTTGCGTGCTGTGCTGACCGGCCTGTTCGACGTCCCGGTGCAGGTG
CAGGAATTGGTTGCCAACTGGTTGACGCTGCCCGAGGAAGGGCGATTGCGGATGGGACGTGCTGCTGCGC
GTATCGGGCGTGACGCCACGCTTGGCGCATCGGCGCGCAACGCGCAGCATCGCTTCCGCCTGCGGATCGG
CCCGTTGGAGATCGCCCGCTACCGCGAGTTCCTGCCGGGCGGCCAGGCCCTGGACGTACTGACCGCCGCA
GTACGCGGCTACATCGGCGACGAGCAGGCCTGGGACTTACAACTCGTGCTGGCGCGCGAAGACGTCCCGT
TGCCAGTCCTGGGGCAGGGCCAGCGCATCGGCCTGTCGCTGTGGCTCGGCCACTATCGCCGCCCGCTCGA
TGCCGACCAGCTCGTGCTTACGTCGCCCTGA