SecReT6
Protein ID: 384419465
SecReT6 ID595
T6SS typei3
Gene symbol-
Locus tagXOC_2539
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]2584646..2586523 [-]
ProductSciC protein
NoteTssF
UniProt IDG7TGR3
KEGG IDxor:XOC_2539
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-214, Aligned region: 5..625
Protein Sequence: 625 a.a.     [Download]
>gi|384419465|ref|YP_005628825.1| SciC protein [Xanthomonas oryzae pv. oryzicola BLS256]
MDPRLLHHYNRELQHVREMGAEFAQAYPKVAGRLGMSGIDCADPYVERLLEGFAFLSARVQVELEAQQPA
FAQHLTEMLYPHFLSPVPSMAVVELQPEQGEGIGPAGHVVPRGSALRSLIGHGDRTACEYRTAHAVTLLP
LRLTAASYLTSPAALATLGVPVEPRARAGLRLVFNVEPGLRLDMLALDTLPIFITGADGLAGTLHEQLHA
NALGFVVRARSADGQVLTRTFGPEHLQPQGFDDEQALLPRSERSFSGYRLLQEYFACPERFLFTAFDGLA
QVLTRAACAEFEILVWFDRSVERLDNAVDASNFRLHCTPAINLFPRRGDRIHLHPGISEHHVLADRTRPM
DFEIHGVEQVEGFGDGNAPMQRFEPFYGAQPRSWHERRSAFYALRRQPRRLSTGQRRTGPRSSYVGSEVF
LSLVDGDQAPYSHQLRQLGMQLWCSNRDLPLHMPVGKSSTDFVLDDGGPVASIRCVAGPTRPRSGVTAGD
TRWRLISHLQLNYLSLLDAGDDGATALREMLTLYHDPHDAAARRQVDGVRRIASRPIVRRIPVPGPATYG
RGLEITLTCDDAAFEGQGVYLLASVLRHVFARQASLNSFTETVLCTPERNEVARWPAHLGNRPIL
 
Nucleotide Sequence: 1878 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c2586523-2584646 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGGATCCGCGCCTGCTCCATCACTACAACCGCGAGTTGCAGCATGTGCGCGAGATGGGTGCGGAATTCG
CGCAGGCGTATCCGAAAGTGGCGGGCCGGCTTGGGATGAGCGGTATCGACTGCGCCGACCCGTATGTCGA
ACGTCTGCTGGAAGGGTTTGCCTTCCTGTCTGCGCGCGTGCAGGTCGAACTCGAAGCCCAGCAGCCTGCA
TTCGCGCAGCATCTGACGGAAATGCTGTATCCACATTTCCTGTCGCCGGTGCCGTCGATGGCCGTGGTGG
AGCTGCAACCGGAGCAAGGCGAGGGCATCGGCCCAGCGGGGCACGTGGTGCCGCGCGGCAGCGCGTTGCG
CTCGTTGATCGGGCATGGCGACCGCACCGCCTGCGAATATCGCACCGCGCACGCGGTGACGCTGTTGCCG
CTGCGCCTGACTGCCGCCAGTTATCTCACCTCGCCGGCAGCGCTGGCCACGCTCGGTGTGCCGGTCGAGC
CGCGCGCGCGCGCCGGCCTTCGCCTGGTCTTCAACGTCGAACCCGGGCTGCGCCTGGACATGCTGGCGCT
GGACACATTGCCGATCTTCATCACCGGCGCAGATGGGTTGGCCGGCACCCTCCACGAACAACTGCATGCC
AATGCGTTGGGATTTGTGGTGCGTGCCCGCTCCGCGGATGGGCAGGTGCTGACGCGCACCTTCGGTCCCG
AGCATCTGCAGCCGCAGGGCTTCGATGACGAGCAGGCGCTGCTGCCGCGCAGCGAACGCTCTTTCAGCGG
CTATCGCCTGCTGCAGGAATATTTTGCCTGCCCCGAGCGTTTCCTGTTTACCGCCTTCGATGGCCTGGCG
CAGGTGCTGACGCGAGCGGCGTGCGCCGAATTCGAGATATTGGTGTGGTTCGACCGCAGCGTCGAGCGGC
TCGATAACGCGGTGGACGCAAGTAACTTCCGCCTGCATTGCACCCCGGCGATCAACCTGTTTCCTCGGCG
CGGTGATCGTATCCATCTGCATCCCGGCATCTCCGAGCACCACGTGCTGGCCGACCGCACGCGGCCGATG
GACTTCGAGATTCATGGCGTGGAGCAGGTCGAAGGCTTCGGCGATGGCAATGCGCCAATGCAGCGTTTCG
AGCCGTTCTATGGCGCGCAGCCGCGCAGTTGGCATGAGCGGCGTTCGGCATTTTATGCCTTGCGACGGCA
GCCGCGGCGGCTGTCGACGGGACAGCGTCGTACCGGGCCGCGCTCGAGCTACGTTGGCAGCGAGGTGTTC
CTGTCGCTGGTCGATGGCGACCAGGCGCCGTATTCGCACCAACTGCGGCAACTGGGCATGCAGCTGTGGT
GCAGCAACCGTGATCTGCCGCTGCATATGCCGGTGGGCAAATCCAGCACCGACTTCGTCCTGGACGATGG
CGGCCCGGTGGCGTCGATCCGCTGCGTTGCAGGTCCAACGCGACCGCGCTCGGGCGTGACCGCCGGCGAT
ACCCGCTGGCGCCTGATCAGCCATCTGCAGTTGAACTATCTCTCGCTGCTGGATGCCGGCGACGACGGTG
CCACCGCATTGCGCGAGATGCTCACGCTGTACCACGACCCGCACGATGCCGCTGCGCGACGACAGGTAGA
CGGCGTGCGCCGCATCGCTTCGCGCCCGATCGTACGGCGCATTCCGGTGCCGGGTCCGGCCACCTATGGC
CGCGGGCTTGAGATCACCTTGACCTGCGACGACGCGGCCTTTGAAGGGCAGGGCGTCTATCTGCTTGCCT
CGGTGCTGCGGCATGTCTTTGCGCGCCAGGCATCGCTCAATTCCTTTACCGAAACCGTGCTATGCACGCC
CGAACGCAACGAGGTCGCTCGATGGCCAGCCCATCTCGGCAATCGGCCGATCCTGTAG