SecReT6
Protein ID: 384419466
SecReT6 ID595
T6SS typei3
Gene symbol-
Locus tagXOC_2540
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]2586527..2587030 [-]
Producthypothetical protein
NoteTssE
UniProt IDG7TGR4
KEGG IDxor:XOC_2540
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-20, Aligned region: 36..144
Protein Sequence: 167 a.a.     [Download]
>gi|384419466|ref|YP_005628826.1| hypothetical protein XOC_2540 [Xanthomonas oryzae pv. oryzicola BLS256]
MAELTQQERLQPSLLDRLIDDRRHEPAESRDARAISPAKLRDCVMRDLAWLLNCTRHWHEDALQAYPHVA
SSVLNYGIPDLAGARLAGLDVIALQNRIREAIVAFEPRLAAASLQVTAKVDIGRMDRMSLSFVIDSELWA
QPLPLALYLRTDLDLETGRFSLSSAGH
 
Nucleotide Sequence: 504 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c2587030-2586527 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGGCCGAACTGACCCAACAAGAGCGTTTGCAGCCATCGCTGCTGGACCGATTGATCGACGACCGCCGAC
ACGAACCGGCGGAAAGCCGCGACGCGCGGGCGATCAGTCCAGCCAAGCTGCGCGACTGCGTCATGCGCGA
CCTGGCCTGGCTGCTCAATTGCACGCGCCACTGGCATGAGGATGCGTTGCAGGCGTATCCGCACGTCGCC
AGCTCGGTACTCAATTACGGCATTCCCGACCTGGCCGGCGCACGGCTGGCGGGGCTGGACGTGATCGCAC
TGCAGAACCGCATTCGTGAGGCGATTGTGGCGTTCGAGCCGCGCCTGGCTGCGGCCAGCCTGCAGGTCAC
CGCGAAAGTGGATATCGGGCGCATGGACCGCATGTCGCTGTCCTTCGTCATCGATTCCGAATTGTGGGCA
CAGCCGCTGCCGCTTGCGCTGTATCTGCGCACCGATCTCGATCTGGAAACCGGTCGTTTCAGTCTGTCTT
CGGCAGGCCACTGA