SecReT6
Protein ID: 384419467
SecReT6 ID595
T6SS typei3
Gene symbol-
Locus tagXOC_2541
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]2587018..2587851 [-]
ProductImpE protein
NoteTagJ
UniProt IDG7TGR5
KEGG IDxor:XOC_2541
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.10E-39, Aligned region: 144..266
TPR_19 [PF14559], Evalue: 0.00084, Aligned region: 13..68
TPR_19 [PF14559], Evalue: 0.00084, Aligned region: 113..132
TPR_14 [PF13428], Evalue: 0.0036, Aligned region: 13..46
TPR_14 [PF13428], Evalue: 0.0036, Aligned region: 43..68
TPR_14 [PF13428], Evalue: 0.0036, Aligned region: 113..134
TPR_16 [PF13432], Evalue: 0.0095, Aligned region: 12..67
TPR_16 [PF13432], Evalue: 0.0095, Aligned region: 113..137
Protein Sequence: 277 a.a.     [Download]
>gi|384419467|ref|YP_005628827.1| ImpE protein [Xanthomonas oryzae pv. oryzicola BLS256]
MSAVHPEHACARLLKAGDPAQSLATAKDWVRQCPADAQARIGLFQLLAVAGEWQRAQQQLRLAAELDQGW
GGVVAAYVRILDAELEREQVLAGRMMPLMPGQVPPWQQDLLQALQHDRDGEPGQAARRRALALTQADAIA
GHIDGRRFDWLADADPRFGPCLEVILEVGYAWVPFVQLRSLCLEAPTTLRDLLWQSVDIQWHDGTRSRGV
VPCRYPGSQHSEQGAIRLGQRTEWKGEALSACGLGQRLLAGSEDDYPVLDIRHIAFDTAAVEAPWPN
 
Nucleotide Sequence: 834 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c2587851-2587018 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGTCTGCTGTCCATCCCGAACATGCCTGCGCCCGCCTGCTCAAGGCGGGCGACCCGGCGCAATCGTTGG
CCACCGCCAAGGACTGGGTGCGGCAGTGCCCGGCCGATGCCCAAGCGCGCATCGGGCTGTTCCAACTGTT
GGCGGTGGCTGGAGAGTGGCAGCGCGCGCAACAACAATTGCGCCTGGCCGCGGAGTTGGACCAGGGTTGG
GGCGGGGTCGTGGCTGCGTATGTGCGCATCCTCGACGCTGAACTGGAACGCGAACAGGTGCTGGCCGGCC
GAATGATGCCGCTGATGCCTGGTCAGGTCCCGCCGTGGCAGCAGGATCTGCTGCAGGCATTGCAGCATGA
TCGCGACGGCGAACCAGGGCAGGCAGCGCGACGGCGTGCCCTGGCGCTTACGCAAGCCGATGCCATCGCT
GGCCATATCGATGGCCGGCGTTTCGACTGGCTGGCCGACGCCGACCCGCGTTTTGGTCCGTGCCTTGAGG
TCATCCTCGAAGTGGGCTACGCGTGGGTGCCGTTCGTCCAATTGCGCAGCCTGTGCTTGGAAGCCCCGAC
CACGCTGCGCGACTTGCTATGGCAGTCGGTCGACATCCAATGGCATGACGGCACACGCAGCCGTGGCGTG
GTGCCGTGCCGTTACCCCGGTAGCCAACACAGCGAGCAGGGCGCGATCCGCCTTGGCCAGCGCACCGAAT
GGAAGGGCGAGGCGTTGTCCGCATGCGGTCTGGGGCAACGCTTGCTGGCTGGCAGCGAGGACGACTACCC
GGTGCTCGACATCCGCCACATCGCATTCGACACCGCCGCGGTGGAAGCGCCATGGCCGAACTGA